KEGG   Exiguobacterium sibiricum: Exig_0927Help
Entry
Exig_0927         CDS       T00687                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Exig_0927
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Exig_0927
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Exig_0927
Enzymes [BR:esi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Exig_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
976504..977703
Genome map
AA seq 399 aa AA seqDB search
MTRYSQPDALGQYGIYGGRYIPETLMQAVLELEQAYAEVKEDPAFRERMNDLLENYVGRQ
TPLYYAEHLTRTIGGAKIYLKREDLNHTGAHKINNTIGQALLAERMGKRKIVAETGAGQH
GVATATVCALLDLECVIFMGEEDIRRQELNVFRMELLGAKVVSVTQGSRTLKDAVNEALR
YWVKHVDDTHYLMGSVLGPHPFPEIVRDFQAVIGQETRTQILEKEGKLPEAIVACVGGGS
NAIGMFHPFIDDEEVALYGIEAAGSGLETEKHAATMSKGEVGVLHGSMMYLLQDEHGQVT
EAHSISAGLDYPGVGPEHSLLKDIGRVQYEAVTDQQALDALQLLCQKEGIIPALESAHAV
AHAKELARGMQPEEVVVICLSGRGDKDVMTVRNALKGEA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacacgttattcacaaccggacgctttaggacagtacgggatttacggaggacgttat
atcccggaaacgttgatgcaggctgttctcgaactggaacaagcctatgccgaagtgaag
gaagacccggcatttcgtgaacggatgaatgatttgctggaaaactacgtcggccggcaa
actccgctttattatgcggaacatttgacacggacaatcggcggcgccaaaatctacctg
aaacgggaagacttaaatcataccggagcgcacaaaatcaacaatacgatcgggcaagcc
ttactcgctgagcggatggggaaacgtaaaatcgtcgccgagaccggagcgggacaacac
ggtgtcgcgacagcaaccgtttgtgcactgcttgatctcgaatgtgtcatcttcatgggc
gaagaggatatccgccgccaggaactaaacgtcttccggatggagttgctcggcgcgaaa
gtcgtgtccgtcacccaaggaagccggacgttaaaagatgccgtcaatgaagcattgcgc
tactgggtcaaacatgtcgacgatacgcattacttgatgggctccgttctcggaccacac
ccgtttccggaaatcgtccgtgacttccaggcagtgatcggacaagagacccggacacaa
atccttgaaaaagaaggcaagttaccggaagctatcgtcgcctgcgtcggcggcggcagt
aatgcaatcggaatgttccacccgtttatcgatgatgaagaggttgccttgtacggcatc
gaagcagccggtagcggactcgagacggagaaacacgccgcgacgatgtcgaaaggtgaa
gtcggagtcttgcacggctcgatgatgtacctgttgcaggatgagcatggtcaagtgacg
gaagcacactcgatttcagcgggacttgattatccgggcgtcggaccggaacacagcctg
ttaaaagacatcggccgcgtccagtatgaagcggtgaccgatcagcaggcactggatgcc
ttgcaactgctttgccaaaaagaaggcatcattcccgcactcgaatcagctcatgccgtt
gcccatgcaaaggaacttgcgagagggatgcaaccggaagaagtcgtcgtcatctgtctc
tcaggacgcggcgataaggatgtcatgaccgtcagaaatgccttaaagggggaagcatga

DBGET integrated database retrieval system