KEGG   Exiguobacterium sibiricum: Exig_0928Help
Entry
Exig_0928         CDS       T00687                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Exig_0928
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Exig_0928
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Exig_0928
Enzymes [BR:esi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Exig_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
977703..978482
Genome map
AA seq 259 aa AA seqDB search
MRLEQAIRTVNARGEKAFIPYVMGGDGGIDRLPDILAFLERSGATAIEVGVPFSDPVADG
PVIQEAGLRALADNISLKDVLEAIRIARQSTGVPIVVMTYLNPIFRFGIDTFLSTCREVG
VDGLIIPDLPLEQSDQFFAGRNKQDIALVQLVSLTSPMERIEKLAAHSEGFLYAVTVNGT
TGGQTNFGDSLEQHLAKVAQLSPVPVMAGFGISTPEHVRQLSTSVAGVIVGSKIVELLQQ
GDEATIEQLMAARLPDVTV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcgattagaacaagcgattcgcacagtcaatgcacgtggtgaaaaagcctttatcccg
tatgtgatgggaggagacggaggcatcgaccgtctgccggatattttagcgttcctcgaa
cgatcgggtgcgacggcaattgaagtcggtgtcccgttttccgatccggtcgccgatggt
ccggtcattcaggaggcaggtttgcgggcactggcggataatatcagtctgaaggatgtt
ctcgaagcaatccggattgcccgtcagtcgacgggcgtgccgattgtcgtcatgacttac
ttgaatccgattttccgcttcggcattgatacttttttatcgacctgtcgtgaagtcggc
gtcgacggactgattattcctgatttaccgctcgagcaaagcgatcagttttttgccgga
cgcaataaacaggacatcgcactcgttcaactggtgtcgttgacaagtccgatggaacgg
attgagaaactggcggcgcacagtgaaggattcctctatgctgtgactgtcaacggaacg
accggtggacagacaaacttcggggattcgctcgaacagcatttggcaaaagtggcacag
ctgagtccggtgccggttatggccggtttcggaatcagtacgccggaacatgtccgtcaa
ctaagtacaagtgttgccggtgtcatcgtcggcagtaagatcgtcgaattgttgcaacag
ggagatgaagcgaccatcgaacagttgatggcggcccgtctgccggacgtgacggtgtaa

DBGET integrated database retrieval system