KEGG   Exiguobacterium sibiricum: Exig_1138Help
Entry
Exig_1138         CDS       T00687                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
esi  Exiguobacterium sibiricum
Brite
Enzymes [BR:esi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Exig_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1184232..1184969)
Genome map
AA seq 245 aa AA seqDB search
MRLLPPKPFYYEGGKKAVLLLHSFTSNANDMKNLGSYLQQNQYSCYAPTFSGHGLPAEDL
LSYGPSDWWQDVLDGYQLLKDKGFERIAVVGLSLGGVLALKMGQESKVNGVVTMSVPMYK
EAAVLKERIFYYGRRYKQLEGKEEQQIESEMAELHHLPFDSLADFEQLINRTRDQLARVV
SPVCVMYGEMDDPSYKTSAEKVFQSVTSDQKTIKGFAHSKHLMTLGKDMNEINQDILTFL
NELKW
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagactattacctccaaaacccttttattatgaaggtggaaaaaaagctgttctgctc
ttacattccttcaccagcaatgcgaatgatatgaaaaatcttggaagttatttgcagcaa
aatcagtattcttgctatgccccgacattcagtggacatggtctgccggcagaagatctt
ttgtcgtatggaccatctgactggtggcaggatgttctcgacggttatcaactgttaaaa
gacaaagggttcgaacgtatagcagtcgtcggtctttcccttggcggtgtacttgctcta
aaaatgggacaggagtccaaggtaaacggcgtggtaaccatgtccgtacccatgtataaa
gaagcagccgttctaaaagaacgaatattttattatggccggcggtataaacaacttgaa
ggaaaagaggagcaacagatcgaatctgaaatggcagaacttcatcaccttccctttgat
tcgctagccgactttgaacaactcattaaccggacgagagaccagttggcacgggtcgtc
tcgcctgtttgcgtcatgtatggggaaatggatgacccctcgtacaagacgagtgccgag
aaggtttttcaaagcgtaacttcggatcaaaaaacgattaaaggatttgcgcattccaaa
cacctgatgacattaggcaaagatatgaacgaaatcaaccaagatattcttaccttttta
aatgaactgaaatggtga

DBGET integrated database retrieval system