KEGG   Exiguobacterium sibiricum: Exig_1197Help
Entry
Exig_1197         CDS       T00687                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
esi  Exiguobacterium sibiricum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Exig_1197
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Exig_1197
Enzymes [BR:esi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Exig_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1238562..1239800
Genome map
AA seq 412 aa AA seqDB search
MKRMVPVLLASVLLAGCADEPAQPVEPQPKPAKKTKPPQPDRPSAAERAEKQLKETVSNM
STAEKVDQLLYIGVTGTALTQADRTLLQDHALGGVLLLGGNITSTDQLKTFTAAIAEAQP
ADAKAFLGFDEEGGRVSRVPDAQLKLSPSLSFGQKNDPALMKEVGQTLGSISRFYGFNMD
FAPVLDVNSNPANPIIGDRALSADPQQVARLGVPLMQGMKKEDIVPVVKHFPGHGDTTVD
SHVGLPRVDATKAELEQTELVPFKRAIEEGTEMVMVAHILFPALDKNRPSSLSKPVMTGV
LRDELKFDGVIITDDLVMGAITEQYGLAQAASLALENGADMAMFSAPGAYTSVHKEIMAR
IKQDKLSRADLDQKVIRVLRLKQTYDLSQTKRVDEYQRLIEQVKAVEADMRH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacggatggttcctgttctgttggcaagtgtcctcctcgccggttgtgctgacgag
ccggcacaaccggtcgaaccgcaaccgaagccggcgaagaaaacaaagccgccgcagccg
gatcgaccttctgctgctgagcgggcagagaaacaacttaaagaaaccgtctcgaacatg
tcgacggcggaaaaagtcgatcagttgctgtatatcggtgtgacgggaacagctttgaca
caagccgaccgaacgctgttgcaggatcatgcactcggtggtgtgctgttactcggcggc
aacatcacgtcgaccgatcaactgaaaacctttacggcagcgattgctgaagcccaaccg
gctgatgcaaaagcgtttctcggctttgacgaagagggcggacgcgtcagtcgggtcccg
gacgcacagctcaaattatcaccgagtctgtcgttcggtcaaaaaaatgatccggcattg
atgaaggaagtcggacagacacttggttcgatttcccgtttttacggctttaatatggac
ttcgccccggttcttgacgtgaacagtaatccggcgaatccgatcatcggcgaccgggca
ctcagtgcggatccgcaacaggtcgcacggctgggtgtgccgttgatgcagggaatgaaa
aaagaagacatcgttccggtcgtcaaacattttccgggacacggtgacacgacggtcgat
tcccatgtcggtctgccgcgggtcgatgcgacaaaagcggaactcgaacagacggaactg
gtcccgttcaagcgggcgattgaagaggggaccgagatggtcatggtcgcgcacatcctg
ttcccggccctcgacaaaaaccgtccgtcttcattgtcaaaaccggtcatgaccggcgtc
ttgcgggatgaactgaagtttgacggagtcatcatcacggatgatctcgtcatgggagcg
attacggaacagtacggtcttgcccaggccgcaagtcttgcgcttgaaaacggtgccgac
atggcgatgttctcggctccgggtgcgtatacgtccgtccacaaggaaatcatggcacgg
atcaaacaagataaattgtcgagagccgatctcgatcagaaggtcatccgggttttacgc
ttaaaacaaacgtatgacttgtcgcaaacgaaacgtgtcgacgaataccaacgcttgatc
gagcaggtcaaagcggtcgaagcggacatgcgacattaa

DBGET integrated database retrieval system