KEGG   Exiguobacterium sibiricum: Exig_1197Help
Entry
Exig_1197         CDS       T00687                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
esi  Exiguobacterium sibiricum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:esi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:esi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1238562..1239800
Genome map
AA seq 412 aa AA seqDB search
MKRMVPVLLASVLLAGCADEPAQPVEPQPKPAKKTKPPQPDRPSAAERAEKQLKETVSNM
STAEKVDQLLYIGVTGTALTQADRTLLQDHALGGVLLLGGNITSTDQLKTFTAAIAEAQP
ADAKAFLGFDEEGGRVSRVPDAQLKLSPSLSFGQKNDPALMKEVGQTLGSISRFYGFNMD
FAPVLDVNSNPANPIIGDRALSADPQQVARLGVPLMQGMKKEDIVPVVKHFPGHGDTTVD
SHVGLPRVDATKAELEQTELVPFKRAIEEGTEMVMVAHILFPALDKNRPSSLSKPVMTGV
LRDELKFDGVIITDDLVMGAITEQYGLAQAASLALENGADMAMFSAPGAYTSVHKEIMAR
IKQDKLSRADLDQKVIRVLRLKQTYDLSQTKRVDEYQRLIEQVKAVEADMRH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacggatggttcctgttctgttggcaagtgtcctcctcgccggttgtgctgacgag
ccggcacaaccggtcgaaccgcaaccgaagccggcgaagaaaacaaagccgccgcagccg
gatcgaccttctgctgctgagcgggcagagaaacaacttaaagaaaccgtctcgaacatg
tcgacggcggaaaaagtcgatcagttgctgtatatcggtgtgacgggaacagctttgaca
caagccgaccgaacgctgttgcaggatcatgcactcggtggtgtgctgttactcggcggc
aacatcacgtcgaccgatcaactgaaaacctttacggcagcgattgctgaagcccaaccg
gctgatgcaaaagcgtttctcggctttgacgaagagggcggacgcgtcagtcgggtcccg
gacgcacagctcaaattatcaccgagtctgtcgttcggtcaaaaaaatgatccggcattg
atgaaggaagtcggacagacacttggttcgatttcccgtttttacggctttaatatggac
ttcgccccggttcttgacgtgaacagtaatccggcgaatccgatcatcggcgaccgggca
ctcagtgcggatccgcaacaggtcgcacggctgggtgtgccgttgatgcagggaatgaaa
aaagaagacatcgttccggtcgtcaaacattttccgggacacggtgacacgacggtcgat
tcccatgtcggtctgccgcgggtcgatgcgacaaaagcggaactcgaacagacggaactg
gtcccgttcaagcgggcgattgaagaggggaccgagatggtcatggtcgcgcacatcctg
ttcccggccctcgacaaaaaccgtccgtcttcattgtcaaaaccggtcatgaccggcgtc
ttgcgggatgaactgaagtttgacggagtcatcatcacggatgatctcgtcatgggagcg
attacggaacagtacggtcttgcccaggccgcaagtcttgcgcttgaaaacggtgccgac
atggcgatgttctcggctccgggtgcgtatacgtccgtccacaaggaaatcatggcacgg
atcaaacaagataaattgtcgagagccgatctcgatcagaaggtcatccgggttttacgc
ttaaaacaaacgtatgacttgtcgcaaacgaaacgtgtcgacgaataccaacgcttgatc
gagcaggtcaaagcggtcgaagcggacatgcgacattaa

DBGET integrated database retrieval system