KEGG   Exiguobacterium sibiricum: Exig_1232Help
Entry
Exig_1232         CDS       T00687                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Exig_1232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_1232
   00620 Pyruvate metabolism
    Exig_1232
   00650 Butanoate metabolism
    Exig_1232
  Lipid metabolism
   00071 Fatty acid degradation
    Exig_1232
  Amino acid metabolism
   00350 Tyrosine metabolism
    Exig_1232
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Exig_1232
   00626 Naphthalene degradation
    Exig_1232
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Exig_1232
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Exig_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1270359..1272953
Genome map
AA seq 864 aa AA seqDB search
MAVKEKIKSEVTPVEKAINQIVAKGQTALQELLTFDQTKIDTIVRDMALAGLERHVELAR
LAVEETGRGVFEDKMIKNMFATEYIYNSLRNEKTVGILEEDVQNGLTYIAEPVGVVCGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSLEAAKTLRDAAVKAGAPKDCIQWVE
QPSLEATKVLMNHTDIAMVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKTAKIKRAV
SDLVLSKTFDNGMICASEQAVIVDQEIYAEVRAEMEALGCYFCTPDEKKRLEALVIKTDT
CAVNADIVGKPATWIAAKAGIDVPGNTVMLVAELEKVGAEEPLSHEKLSPVLGAYSVAST
KDAFHVAERMLEIGGLGHTAVIHTTDDELMTAFGLRMKACRILVNSPSAHGGIGDLYNEL
TPSLTLGCGSYGKNSVSENVTAKHLLNVKKVARRRVNMQWFKVPEKIFFEKNSVQYLKSI
QNVSRALIVTDQSMVEFGYADKVIRNLPAGVSYRIFDQVEPDPSVTTVQVGAQAMRDFKP
DLIIALGGGSAMDAAKGMWLFYEQPNETFSNLRQKFMDIRKRAYKFPELGNKAKFVAIPT
TSGTGSEVTPFTVITDKEKNVKYPIADYALTPDVAIVDPEFVMTVPASITADTGMDVLTH
ATEAFVSVLANDYTDGLALKAIKMIFEYLPRAYDNGSDAEAREKVHNASTMAGMAFANAF
LGINHSIAHKIGGEFHTPHGRTNAILMPHVIRYNATKPTKLAAFPKYESFIADERYAEIA
RYLGLPAATTEQGVESFIQAVSELGQRLNIKMSFKAQGINKADFEAKLDKMAVDAFEDQC
TTANPKMPLVTELRQIMEFAYEGI
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaaagaaaaaatcaaatcagaagtcacacctgtcgaaaaagcaatcaatcaa
atcgtcgcgaaaggtcaaacggcacttcaagaattgttgacatttgatcaaacgaaaatt
gatacgatcgtccgcgacatggcgctcgccggtctcgaacggcacgtcgaacttgcccgt
cttgcggtcgaagagacaggtcgtggtgtctttgaagataaaatgatcaaaaacatgttt
gcgacagagtacatctacaacagtctccgcaacgaaaaaacggtcgggattttagaagag
gatgtccaaaacggtctgacgtatatagcggagccggtcggtgtcgtctgtggtgtcaca
ccggtgacgaatccgacatcaaccacgatgttcaaagcattgatcgcgattaaaacacgg
aacccgatcatcttcgcgttccacccgtcggctcaaaattgttccctcgaagcagcgaaa
acattacgggatgcggccgtcaaagcaggtgcaccaaaagattgtatccagtgggtcgaa
caaccgtccctcgaagcaacaaaagttttgatgaaccacacggacatcgcgatggtcctt
gcgacaggcggagccggcatggtcaaatccgcttactcgaccggaaaaccggcgcttggt
gtcggaccggggaacgtaccgtgttacatcgaaaaaaccgctaaaatcaaacgggctgtc
agtgacttggttctgtccaaaacatttgataacggaatgatttgtgcgtccgagcaagca
gtcatcgtcgatcaagagatttatgccgaagtgcgggccgaaatggaagccctcggttgc
tacttctgtacaccggatgagaaaaaacgcctcgaagcacttgtcatcaaaaccgataca
tgtgccgtcaatgcggacatcgtcgggaaacctgcgacctggatcgccgcgaaagccggt
atcgatgttccaggcaacacggtcatgcttgtcgcggaactcgaaaaagtcggagccgaa
gaaccattgtcacacgaaaaattaagtccggttctcggtgcatacagtgtcgcctctaca
aaagatgccttccatgttgccgaacggatgcttgaaatcggcggactcggtcacacggcg
gtcattcatacgacggatgatgagttgatgacagcgtttggtctccggatgaaagcctgc
cggattctcgtcaacagtccatcggcccacggcggaatcggcgatctctacaacgagttg
acaccatcgctgacactcggctgcggatcatacgggaaaaactcggtttctgaaaacgtt
acggcgaaacatctactcaatgtcaagaaggtggcgagacgacgcgtgaacatgcaatgg
ttcaaagtaccagaaaagattttctttgaaaaaaactcggtgcaatacttgaaatcgatt
caaaatgtctcacgggctttaatcgtcactgatcaatcgatggtcgagttcggctatgcc
gataaagtcatccgtaatctgccggccggcgtcagctaccggatctttgaccaagtcgaa
ccggatccatcggtgacgaccgttcaagtcggtgcccaggcgatgcgtgattttaaaccg
gacttgatcatcgcgcttggcggtggatcagcgatggatgccgcgaaaggcatgtggtta
ttctatgagcaaccaaacgaaacattctcgaatctgcgccaaaaattcatggatatccgc
aaacgggcctataagttcccggaactcggcaacaaagcgaagttcgtcgccattccgaca
acgtccggtacaggatcagaagtcacgccgttcactgtcatcaccgataaagagaaaaac
gtcaaatatccgattgctgactatgcgttgacaccagacgtcgcaatcgttgatccggag
tttgtcatgacggtgccggcttcaatcacggcggataccggaatggacgtcttgacacac
gcaacagaagctttcgtctctgtccttgcgaacgactacacggatggactggcgttaaaa
gcaatcaagatgatctttgagtacttgccacgtgcttacgataacggttcagacgccgaa
gcacgcgaaaaagtccacaatgcgtcaacgatggccggaatggcgtttgcgaatgccttc
ctcggcatcaaccactcaatcgcgcacaaaatcggtggggagttccacacaccacacggt
cggacaaatgcgattctgatgccacacgtcatccgttacaatgcaacaaaaccaacgaaa
ctggctgctttcccgaaatacgagtcgtttatcgcggatgaacggtatgcggaaatcgcc
cgttacctcggtctaccggcagcaacgacagaacaaggcgtcgagtcgttcattcaagcc
gtcagtgagctcggacaacgcctcaacatcaagatgtcgtttaaagcccaaggcatcaac
aaagctgactttgaagcgaaactcgacaagatggccgtcgatgcgtttgaagatcaatgt
acgaccgccaatccgaaaatgccgcttgtgacggaactccgtcaaatcatggaatttgcg
tacgaaggtatctaa

DBGET integrated database retrieval system