KEGG   Exiguobacterium sibiricum: Exig_1450Help
Entry
Exig_1450         CDS       T00687                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:esi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1444311..1445771
Genome map
AA seq 486 aa AA seqDB search
MKTLPNDFLWGGALAAHQFEGGWNAGGKGPSVVDVMTAGEHGVARRITETIEEGTFYPNH
EAIDFYHRYKEDIALFAEMGLKCLRTSIGWSRIFPNGDETEPNEAGLQFYDDVFDELLKH
GIEPIITLSHFEMPLHLAREYGGFRNRKVAEFFERFAEVCFTRYKDKVTYWMTFNEINNK
MDVENPLFLWTNSGVKVEPGENAMEVMYQTGHHELIASALVVAKGKAINPDFQIGAMISH
VPIYPYSSHPEDVMLAEKSMRQRYFFPDVQARGYYPNYALKEFEREGYQIPILDGDDEIL
KNGTVDYIGFSYYMSTTVKHDATVNNTGNIVNGGLANGVENPYIQSSDWGWAIDPIGLRY
VLNRLYDRYQLPLFIVENGFGAVDTIEDGKIHDAARIDYLKTHIEALTEAVTEDGVELMG
YTPWGIIDIVSFTTGEMKKRYGMIYVDRDNEGNGSMERMKKDSFDWYKQVIATNGQDLAY
DKAAQR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaccaaacgattttttatggggcggggcactcgctgcccatcaatttgaa
ggcggctggaacgccggcggcaaaggaccaagcgtcgtcgatgtcatgacggctggtgaa
cacggggttgcccgccggatcaccgagacgattgaagaaggaacgttttatccgaaccat
gaagcgatcgatttttatcaccgctataaagaagacatcgccctgtttgctgaaatgggt
ctgaaatgtctccggacgtcgatcggctggagccggattttcccgaacggcgatgaaacg
gaaccgaacgaagccggactgcagttttatgatgatgtgtttgacgaattgttgaaacac
ggtatcgaaccgatcatcacgttatcacacttcgagatgccgttgcatctggcccgcgaa
tacggcgggttccgcaatcggaaagtcgccgagttcttcgaacggttcgctgaagtctgc
ttcacacgttacaaagacaaagtaacgtactggatgacgttcaacgaaatcaataataag
atggatgtcgaaaatccgttgttcctctggacgaactccggtgtcaaagtcgagccgggt
gaaaacgcgatggaagtcatgtatcagaccggtcaccacgagctgattgcgagtgccctt
gtcgtcgcgaaaggaaaagcgatcaatcccgacttccagatcggggcgatgatttcacac
gtcccgatctatccgtactcgtcgcatccggaagacgtcatgctggcggaaaaatcgatg
cgtcagcgctatttcttcccggatgttcaagcgcgcggttattatccgaactatgcctta
aaagagttcgaacgcgaagggtatcagattccgattctcgacggtgacgacgagatcctg
aaaaacggaacggtcgactatatcggcttcagttactacatgtcgacgaccgtcaagcac
gacgcgactgtcaacaatacaggcaacatcgtcaacgggggactggcgaacggtgtcgag
aatccgtacatccagtcgagcgactggggttgggcgattgatccgattggactccgctac
gtcctgaaccgtctctatgaccggtaccaactcccgctcttcatcgtcgaaaacggcttt
ggggccgtcgatacgattgaagacggcaagattcatgatgctgcgcggatcgattacctg
aagacgcacatcgaagcattgacggaagcggtcacggaagacggcgtcgaattaatgggg
tacacaccatggggcatcatcgacatcgtgtcgttcacgacaggtgagatgaaaaaacgc
tacgggatgatttatgtcgaccgtgacaacgaagggaacggctcgatggaacggatgaaa
aaagattcgttcgactggtacaaacaggtcatcgcaacaaacggacaagacttggcatat
gacaaagcagcacaacgttaa

DBGET integrated database retrieval system