KEGG   Exiguobacterium sibiricum: Exig_1536Help
Entry
Exig_1536         CDS       T00687                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00071  Fatty acid degradation
esi00350  Tyrosine metabolism
esi00625  Chloroalkane and chloroalkene degradation
esi00626  Naphthalene degradation
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_1536
  Lipid metabolism
   00071 Fatty acid degradation
    Exig_1536
  Amino acid metabolism
   00350 Tyrosine metabolism
    Exig_1536
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Exig_1536
   00626 Naphthalene degradation
    Exig_1536
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Exig_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N
Motif
Other DBs
NCBI-ProteinID: ACB60993
JGI: Exig1536
UniProt: B1YGI9
Position
complement(1511207..1512205)
Genome map
AA seq 332 aa AA seqDB search
MKAMTISKYGQVPLEQTEQPRPDVRPHDVLVEIHAASINPVDFKIRDGDVKLLIPYQFPL
ILGNDFAGIIVEVGHAVKQFQVGDAVYGRAEKNRIGTFAEYIAIDEQMLALKPASLSFEE
AASIPLVGLTSYQALHDVLQATPGQKILIQAGAGGVGTFAIQLAKAMGLYVATTASSAGH
DLVASLGADEIIDYRTEAFDEVLHDYDGVYDTIGGETLRRSFKIVRPGGHIVSISGLPNG
RFGKSYRSGFLKTNLFRLLTLRETWLERKHRVTYTFLFMRPSGRQLEHITEWIETGQIKP
VIDRIYPFEEAQAALEYSESGRAKGKVVLQMK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgacgatttcaaaatacggacaggttccgctcgaacaaaccgaacagccc
cgcccggacgtccgcccgcatgacgttcttgtcgaaattcacgcggcgagcatcaatccg
gttgattttaagattcgggacggtgacgtcaagctgttgatcccgtatcagttcccgctg
attctcgggaatgacttcgccggcatcattgttgaagtgggtcatgccgtcaagcagttt
caagtcggtgatgccgtctacggacgggccgagaaaaatcgaatcggtacctttgcggaa
tacatcgcaatcgatgaacagatgcttgccctaaaaccggcgtcgctctcctttgaggaa
gcagcctccatcccgctcgtcggcttgacgtcctatcaggcattacacgacgtcttgcag
gcgacgccgggacaaaagatcctgatccaggccggtgcgggcggcgtcggcacgtttgcc
atccaactagcgaaagcaatgggcttgtacgtcgcaacgacggcgagttccgccggacat
gatttggttgcgtcacttggcgctgatgaaatcatcgattaccggacggaagcgtttgac
gaagtcctgcatgattatgacggtgtctacgatacgatcggcggtgagacgctccggcgt
tcgtttaaaatcgtccgtccgggcggacacatcgtctcgatttccggactgcctaacggc
cggttcgggaaatcctaccggtccggttttctgaagaccaacctgttccgcctgctgacg
ctccgcgaaacatggcttgaacggaaacaccgggtcacgtacacgtttttattcatgcga
ccgagcggacgccaactggaacacattacagaatggattgagaccggacaaatcaaaccg
gtcatcgaccgcatctatccgtttgaagaggcacaggctgcgctcgagtattccgagtcc
ggtcgggccaaaggaaaagtcgtcttacaaatgaaataa

DBGET integrated database retrieval system