KEGG   Exiguobacterium sibiricum: Exig_1633Help
Entry
Exig_1633         CDS       T00687                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00230  Purine metabolism
esi01100  Metabolic pathways
Module
esi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Exig_1633
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Exig_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_18 AAA_22 AAA_16 ABC_tran RsgA_GTPase AAA_33 CPT AAA_24 DUF815 AAA_17 AAA_28 AAA_29 KAP_NTPase dNK PduV-EutP SRPRB Zeta_toxin Roc AAA_19 FeoB_N PRK AAA_PrkA G-alpha AAA_5 POTRA_1 AAA_30 NACHT EFP RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ACB61088
JGI: Exig1633
UniProt: B1YH27
Position
complement(1596191..1596760)
Genome map
AA seq 189 aa AA seqDB search
MSGKIILLIGGSGSGKSSLIKRLRQEYERVRFIPSVTTRPKRPTEHDGESYHFVDVKTFQ
QLIQENGFIEYAHVHRAWYGTPRQAYEEILATDGIVIKDIDPKGATAFKTLFADHVITIF
VSVPPDLMKERLLMRGDTPEFEARLVDYADAWKERDHYDYMIENIDFEQAYADLLSIISS
YIPGQPSES
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtaaaatcattctgttgattgggggatcgggcagcgggaaatcttccttgatt
aaacgattacgccaggaatatgaacgagtccgctttattccgtccgtgacgacacgtccg
aaacgtccgacggaacacgacggggaaagttatcatttcgttgatgtcaaaacgttccag
caactgatccaggagaacggattcatcgaatatgcccacgtccaccgggcatggtacggg
acgccgcgccaggcgtatgaagaaattcttgcgaccgatggaattgtcatcaaggatatt
gatccgaaaggggcgacagcgttcaaaacgttgtttgccgatcacgtcatcacgattttc
gtatccgttccgccggatttgatgaaggaacggttgctgatgcggggggatacgccggag
ttcgaggcacggctcgtcgactatgcggatgcctggaaagagcgcgatcattacgattat
atgattgaaaacatcgactttgaacaagcctatgcggatttgttgagcatcatttcctcc
tatattcccggacaaccgtccgaatcgtaa

DBGET integrated database retrieval system