KEGG   Exiguobacterium sibiricum: Exig_1655Help
Entry
Exig_1655         CDS       T00687                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
esi  Exiguobacterium sibiricum
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1612158..1614209)
Genome map
AA seq 683 aa AA seqDB search
MRQTIYTTKARHLLHGGDYNPDQWLDVPDVLQEDLRLMRLAHTNTYSIGIFAWSALEPTE
NQFTFDWLDRIIDDIHANGGQVILATPSGARPAWLSQTYPQVLRVDEHRIRQLHGGRHNH
CLTSPVYREKTQRINRLLAERYGNHPALLMWHVSNEYGGECHCPLCQAAFRDWLKVKYET
LDALNASWWSAFWSHTFDDWSQIESPSPIGESMVHGLNLDWKRFVTDQTISFFEQESVPL
RELTPNLPITTNFMADTEDLIPFQALDYSRFAKHVDVVSWDAYPTWHNDWETTANLAMKV
GFINDLFRSLKQQPFLLMESTPSAVNWHPVNKAKRPGMHLLSSLQMIAHGSDSVLYFQWR
KSRGSSEKFHGAVVDHDRSEENRVFQEVAHVGQTLEQLDAVVGTTRPAEVGILYDWENNW
ALNDAQGFANDTKQYPQTLQEHYRFFYEQDIPVDVITKEQPFDAYKLLIVPMLYLVSRTT
LRQLQQFVEQGGTVVATYMTGLVDEYDLAYAGWPEELQTIFGLRPAETDTLYPSDRNHVM
FNGKQYELQDYATVIEVEHAEIVGRYTDDFYRQAPAVTKHQLGQGEAWYIGGRLEATFQR
DMYAMLTDRLNIKASFDTTHTAEVSIQVRRGQEADYGFILNFSEVEQTVELFEPLLESAT
QTEISGQLMLKPYEVKIVERKKT
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaacgatttatacgacaaaagcgagacatctgttgcacggcggggactataat
ccggatcaatggctcgacgtaccggacgtcttacaggaagatttacggttaatgcgtctt
gcgcatacgaatacgtattccatcggcatctttgcctggagtgcgctcgaaccgaccgaa
aatcagttcacgttcgactggcttgaccggattattgacgatattcacgcaaacggcgga
caggtaattttggcgacaccaagcggggcacgtccggcctggctgtcgcaaacgtatccg
caagtgttacgtgtcgacgagcaccgtatcagacagttgcacggcgggcgtcataatcac
tgtctgacgtctccggtctaccgtgaaaaaacacaacggatcaaccgcttattggccgaa
cggtacgggaatcatccggcactgctgatgtggcatgtttcgaacgaatacggtggcgag
tgccattgtccgctttgtcaggcagcctttcgcgactggctgaaagtgaagtatgagacg
ctcgatgcactgaatgcttcctggtggagtgccttttggagtcatacgtttgacgactgg
tcgcaaatcgagtcgccatcaccgatcggcgaaagcatggtccatggtctgaatctcgac
tggaaacggtttgtgaccgatcagacgatttcgttttttgagcaggaaagtgttcccctg
cgcgagttgacacccaatcttccgatcacgaccaatttcatggcagatacggaagacctg
attccattccaggcccttgactacagtcgattcgcgaaacacgtcgatgtcgtcagttgg
gatgcctatccgacctggcacaatgactgggaaacgacggccaatttagcgatgaaggtc
gggttcatcaatgacttgttccggagtttaaagcaacaaccgttcctcttgatggaatcg
acgccgagtgctgtcaactggcatcccgtcaacaaagcgaaacgtccgggcatgcacctg
ttgtcctcgttgcaaatgattgcccacggttccgacagcgtgctgtacttccagtggcgg
aaatcccgcggctcgtcagaaaagtttcacggggcggtcgtcgaccatgaccggtcggaa
gaaaatcgggtctttcaagaagtcgcccacgtcggacaaacgctggagcaactcgacgcc
gtcgtcggtacgacgcgtcccgcagaggtcgggattctttacgactgggaaaataactgg
gcattaaatgatgcgcaagggttcgcaaacgacacgaaacagtatccgcaaacgctgcag
gaacattatcgtttcttttacgaacaggatattccggtcgatgtcatcacgaaagaacag
ccatttgatgcttacaaactgttaattgtgccgatgctgtatttggtcagtcggacgacg
ctgcggcagttgcaacaattcgtcgaacagggcggtacggtagttgcgacgtacatgacg
ggtctggtcgatgaatatgatttggcgtatgccggatggccggaagaactgcagacaatc
tttggtctgagaccggcggaaacagatacactgtacccaagcgatcgaaatcacgtgatg
tttaacgggaaacagtatgaactgcaggattatgcgacggttatcgaggttgagcacgcg
gaaatcgtcggccgctatacggacgacttttatcgacaggcgccggccgtgacgaaacat
cagctgggacaaggcgaagcctggtatatcggcggacgactcgaggcaacgtttcaacgt
gacatgtatgcgatgttaacggatcggttaaacatcaaggcatctttcgacacgacgcat
acggcagaagtatcgattcaagtgcgacgtggacaggaggcggactacgggttcatcctg
aatttttccgaagtcgagcaaacggttgaactgttcgagccgttgcttgagtctgcaaca
caaacggaaatcagcggtcagctgatgcttaaaccgtatgaagtcaagatcgttgaacgg
aagaaaacatga

DBGET integrated database retrieval system