KEGG   Exiguobacterium sibiricum: Exig_1705Help
Entry
Exig_1705         CDS       T00687                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
esi  Exiguobacterium sibiricum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Exig_1705
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Exig_1705
  Amino acid metabolism
   00310 Lysine degradation
    Exig_1705
Enzymes [BR:esi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Exig_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1661627..1662877)
Genome map
AA seq 416 aa AA seqDB search
MEIKVPELAESITEGTVASWLKQPGDQVEKGEAIVELETDKVNIEVPSDEAGILSEVMAA
EGDTVRVGETIAIITAGGEAAQQAATTPAPEQKEAPVAQEAKKEQPAPVAATEATSVADR
PIASPAARKMAREKGIDLAQVATQDPLGRIRVQDVATFEVAPREQAKAPQAPAPQATPSA
APGKPEERIKMSRRRKTIANRLVEVQQTAAMLTTFNEIDMSAVMSLRKRRQEKFVKDNEV
KLGFMSFFTKAAVAALKKMPYLNAEIQGDEIVLKKFYDIGIAVSAPDGLVVPVVRDADKK
NFGEIEKDIINLAVKARDNKLGLSDLTGGTFTITNGGTFGSLMSTPILNGPQVAILGMHA
INLRPVAIDAERMENRPMMYVALSYDHRIVDGKEAVTFLKHIKDLLEDPESLIFEA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaagtgccagaacttgcagaatcgattacagaaggtacggtcgcatcgtgg
ttaaaacaacccggcgatcaggtagaaaaaggggaagccatcgtcgagctggagacagat
aaagttaacatcgaagtcccatctgatgaagcgggcatcctgtccgaagtaatggcagcc
gaaggggatacagtccgtgtcggagagacgattgccatcatcacggcaggcggagaagcg
gcacaacaggcagcaacaacgccggcaccggagcaaaaagaagcaccggttgcacaggaa
gcgaaaaaagaacagccggcacctgttgctgcgacagaagcgacgtcggttgccgatcgt
ccgatcgcatcaccggctgctcggaaaatggcacgtgaaaaaggaatcgatttagcacaa
gtcgcgacacaagatccactcggacggattcgtgtacaggatgtcgcgacgtttgaagtc
gcgccacgtgaacaagcaaaagcaccgcaagcgccggcaccacaagcaacaccgtctgca
gctccgggtaaaccggaagaacggattaaaatgtcacgtcgccgtaaaacgattgccaac
cgtttagtagaggttcaacaaacggcagcgatgttgacgacgttcaacgaaatcgatatg
tcggctgtcatgtcattacggaagcgccgccaggaaaagttcgtcaaggacaatgaagtt
aagctcggcttcatgtcattcttcacgaaagcagctgttgccgcattgaaaaaaatgccg
tatttgaacgcagaaattcaaggggacgaaatcgttctcaagaaattctacgatatcgga
atcgcagtttctgctccagacggcttggttgtaccagtcgttcgtgacgccgacaaaaag
aacttcggtgaaattgaaaaagatatcatcaatctggctgtcaaagcccgggacaacaaa
ctcggcttatctgatttgacaggtgggacatttacgatcacaaacggcggaacgtttgga
tcattgatgtcgacaccaatcctgaacggaccgcaagtcgcgattctcgggatgcatgcg
attaacctgcgtccggtcgccatcgacgccgagcggatggaaaatcgtccaatgatgtac
gttgcactttcctatgaccaccgaatcgttgacgggaaagaagccgtcacgttcctgaag
cacatcaaagacttgcttgaagatccggagtcattgatttttgaagcttga

DBGET integrated database retrieval system