KEGG   Exiguobacterium sibiricum: Exig_1845Help
Entry
Exig_1845         CDS       T00687                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00900  Terpenoid backbone biosynthesis
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Exig_1845
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Exig_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C NAD_binding_3 Semialdhyde_dh 2H-phosphodiest
Motif
Other DBs
NCBI-ProteinID: ACB61297
JGI: Exig1845
UniProt: B1YI70
Position
complement(1810691..1811845)
Genome map
AA seq 384 aa AA seqDB search
MKQVSIIGGTGSIGTQTLDVIAANPDRFQLVSFAFGKNIEVALPWLNRLRPELVAVLDET
VKEQLEAVLDYSPTVLVGEDGLIAVATADQADIVITAVVGAVGLRPTLAAIEAGKSIGLA
NKETLVTAGHLVMKKAREKGVAILPVDSEHAAIFQCLNGERRQDVRQIILTASGGSFRDQ
TREQLANVTVEQALNHPNWSMGAKITIDSATMMNKGFEVIEAHWLFDVTYDEIDVVLHRE
SIIHSMVEFNDGAVMAQLGMPDMREPIQYALTYPSRLEIKGGERLNLKQIGRLNFAEASF
ERYPLLRLAFEAGRAGGSMPSVLNAANEQAVDRFLKGEISFLEIEASVEAALQAHENIED
PSLDQILESDRWARAFVASLSLAN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggttagtatcattgggggaaccggatcgatcggcacccagacgttagatgtc
atcgcagcaaatccggaccgtttccaactggtcagctttgcgttcgggaaaaacatcgag
gttgctttaccctggctgaatcgtttacgtccggagctggtagcggtcttagacgagact
gtaaaagagcaattggaagcagtacttgactattcgccgacagtacttgtcggggaggac
ggattgattgctgttgcgacagccgaccaagcggatatcgtcattacagccgtcgtcggt
gcagtaggtcttcgaccgacattggctgcaatcgaagcgggaaaatcaattggattggca
aacaaagagacattggtgactgccggacacctcgtcatgaaaaaagcacgcgaaaaaggt
gtcgcgattcttccggtcgacagtgaacatgctgccatcttccagtgcttgaatggtgaa
cggcgtcaggatgttcgacaaatcattttaactgcatcgggcggcagtttccgtgaccaa
acacgggaacagttggcaaacgtgacggtggaacaagcgctgaatcatccgaactggtcg
atgggtgcaaaaatcacgattgactcggcgacgatgatgaacaaagggtttgaagtcatc
gaagcgcactggttatttgatgtgacgtatgacgaaattgatgtggtcctccaccgagaa
tccatcatccactcgatggtcgaattcaatgacggtgcagtgatggctcaactcggaatg
ccggacatgcgtgaaccgattcaatatgcccttacatatccgtcccgccttgaaatcaaa
gggggagaacggttaaacttaaaacaaatcggacgcctgaattttgcggaagcttcattt
gaacggtatccactgcttcgtcttgcgtttgaggcaggacgtgccggcggatcgatgcct
tccgtgctcaatgctgcgaacgaacaagctgtcgaccgttttttaaaaggggaaatcagc
tttttagaaattgaagcgagcgttgaggcggctcttcaagcacatgaaaacatcgaagat
ccgtctttggaccagattttggagtcggatcgttgggcccgtgcgtttgttgcttctctc
tcactcgctaactaa

DBGET integrated database retrieval system