KEGG   Exiguobacterium sibiricum: Exig_1930Help
Entry
Exig_1930         CDS       T00687                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00230  Purine metabolism
esi01100  Metabolic pathways
Module
esi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Exig_1930
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Exig_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_17 AAA_22 Rad17 RsgA_GTPase AAA ABC_tran Cytidylate_kin MMR_HSR1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACB61382
JGI: Exig1930
UniProt: B1YIQ6
Position
complement(1888617..1889237)
Genome map
AA seq 206 aa AA seqDB search
MIFKERGLLLVLSGPSGVGKGTVCRALREDEDNNLHYSVSCTTRKPREGEVDGVHYFFKT
REEFESMIANNQLLEHAEFVGNYYGTPVEWVNKILDEGKDVILEIEVQGAMQVKEHFPEA
VFLFLAPPSLQELRNRLVGRGTESEEVIKQRLLVAKEEIEMMDAYDYVVTNDEIHKACDR
IQAIVTAEHCSRERVASLYKKAMEVK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttaaagagcgtggcttattactcgtattgtctggtccgagtggtgttggtaaa
ggaacggtttgccgtgccttgcgcgaagatgaagacaataatttgcactattctgtgtca
tgtacgacacgtaaaccgcgtgagggagaagtggacggtgtccattatttcttcaagaca
cgtgaagaattcgaaagtatgattgcgaacaaccaattgctcgagcatgcggaatttgtc
ggtaactattatggtacacccgtcgaatgggtcaacaaaatcttagatgaaggaaaagat
gtcatcttggaaattgaagtacagggtgcgatgcaggtgaaggaacattttccggaagct
gtttttctgtttttggctccgccaagtttacaggaacttcgcaaccgtcttgtcgggcgt
ggaacagaatcagaagaggtcatcaaacaacgtcttcttgtcgcgaaagaagagattgaa
atgatggatgcttatgattacgtcgtcacgaatgacgagatccacaaagcatgtgacaga
attcaagcaatcgtcactgcagaacattgtagccgggaacgcgttgcgtccttgtataaa
aaagccatggaggtcaaataa

DBGET integrated database retrieval system