KEGG   Exiguobacterium sibiricum: Exig_1946Help
Entry
Exig_1946         CDS       T00687                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
esi  Exiguobacterium sibiricum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:esi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:esi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1905276..1906193)
Genome map
AA seq 305 aa AA seqDB search
MQTRQRIAHFTSLDALATEDIEQLIERALQLKQGASVRPLPTKTVANLFFEHSTRTKCSF
DMAEHHLGLHVLPFETATSSVQKGETLLDTCKTLQAIGVDALVVRHGETGYYEPLQQQLS
IPIINAGDGSGQHPSQSLLDLMTMYAEYGHVSGKTIVICGDLRHSRVARSNAHVLQRLGA
TVIGSGPREWFDETMGITYREMDEAVATSDIIMLLRVQHERHTDGRPFAAEEYHERYGLT
EQRMKRIQPEAIVLHPAPVNRGVEIADELVEHPQSRIFDQMTNGVFARMAILERAFETAT
IKETR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacgacaacgaatcgcccattttacgagtcttgacgcattagcgacagaagac
atcgaacagttgattgagcgggcactgcagctgaaacaaggcgcatctgtccgaccactt
ccgacgaaaaccgtcgccaacttattttttgaacattcgacacggactaaatgttcgttt
gacatggcggaacatcacctcggactgcatgtgctgccgttcgaaacggcaacttcatcc
gttcaaaaaggggaaacgttgctggatacgtgcaaaacgttacaagcaatcggcgtggat
gccctcgtcgtccggcacggagagaccggttattatgaaccgttgcaacaacagttgtca
attccgatcatcaatgccggagacggtagcgggcaacatccatcacaatcactgctcgat
ttgatgacgatgtatgcggaatacggtcatgtcagcggaaaaacgatcgtcatctgcggt
gatctccggcacagccgggtcgcccggtcaaacgcacacgtcttgcaacgcttgggagcg
accgtcatcggttccggaccgagggaatggtttgacgagacgatgggcatcacctatcgg
gagatggacgaggcggtggcgacgagtgacatcatcatgctgctccgtgtccagcacgag
cggcatacggatggccgtccgtttgcagcggaagagtatcacgaacggtacggattgacg
gaacaacggatgaagcggattcagccggaagcgattgtgttacatccggcaccggtcaac
cgtggtgttgagattgccgacgaattggtggagcatccgcaatcacgcatctttgatcag
atgacgaacggtgtgtttgcccgaatggcgattttggaacgggcatttgagacagcaacg
ataaaggagacgagataa

DBGET integrated database retrieval system