KEGG   Exiguobacterium sibiricum: Exig_1946Help
Entry
Exig_1946         CDS       T00687                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00240  Pyrimidine metabolism
esi00250  Alanine, aspartate and glutamate metabolism
esi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Exig_1946
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Exig_1946
Enzymes [BR:esi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Exig_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C Asp_Glu_race Pantoate_transf
Motif
Other DBs
NCBI-ProteinID: ACB61398
JGI: Exig1946
UniProt: B1YIS2
Position
complement(1905276..1906193)
Genome map
AA seq 305 aa AA seqDB search
MQTRQRIAHFTSLDALATEDIEQLIERALQLKQGASVRPLPTKTVANLFFEHSTRTKCSF
DMAEHHLGLHVLPFETATSSVQKGETLLDTCKTLQAIGVDALVVRHGETGYYEPLQQQLS
IPIINAGDGSGQHPSQSLLDLMTMYAEYGHVSGKTIVICGDLRHSRVARSNAHVLQRLGA
TVIGSGPREWFDETMGITYREMDEAVATSDIIMLLRVQHERHTDGRPFAAEEYHERYGLT
EQRMKRIQPEAIVLHPAPVNRGVEIADELVEHPQSRIFDQMTNGVFARMAILERAFETAT
IKETR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacgacaacgaatcgcccattttacgagtcttgacgcattagcgacagaagac
atcgaacagttgattgagcgggcactgcagctgaaacaaggcgcatctgtccgaccactt
ccgacgaaaaccgtcgccaacttattttttgaacattcgacacggactaaatgttcgttt
gacatggcggaacatcacctcggactgcatgtgctgccgttcgaaacggcaacttcatcc
gttcaaaaaggggaaacgttgctggatacgtgcaaaacgttacaagcaatcggcgtggat
gccctcgtcgtccggcacggagagaccggttattatgaaccgttgcaacaacagttgtca
attccgatcatcaatgccggagacggtagcgggcaacatccatcacaatcactgctcgat
ttgatgacgatgtatgcggaatacggtcatgtcagcggaaaaacgatcgtcatctgcggt
gatctccggcacagccgggtcgcccggtcaaacgcacacgtcttgcaacgcttgggagcg
accgtcatcggttccggaccgagggaatggtttgacgagacgatgggcatcacctatcgg
gagatggacgaggcggtggcgacgagtgacatcatcatgctgctccgtgtccagcacgag
cggcatacggatggccgtccgtttgcagcggaagagtatcacgaacggtacggattgacg
gaacaacggatgaagcggattcagccggaagcgattgtgttacatccggcaccggtcaac
cgtggtgttgagattgccgacgaattggtggagcatccgcaatcacgcatctttgatcag
atgacgaacggtgtgtttgcccgaatggcgattttggaacgggcatttgagacagcaacg
ataaaggagacgagataa

DBGET integrated database retrieval system