KEGG   Exiguobacterium sibiricum: Exig_2009Help
Entry
Exig_2009         CDS       T00687                                 

Definition
(GenBank) Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00020  Citrate cycle (TCA cycle)
esi00620  Pyruvate metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
Module
esi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2009
   00020 Citrate cycle (TCA cycle)
    Exig_2009
   00620 Pyruvate metabolism
    Exig_2009
Enzymes [BR:esi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Exig_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACB61461
JGI: Exig2009
UniProt: B1YJ80
Position
complement(1964745..1966043)
Genome map
AA seq 432 aa AA seqDB search
MGLFEFKLPDIGEGIHEGEIVKWFVKAGDTVKEDDILLEVQNDKAVVEIPSPVDGTVKEV
KVDEGIVAVVGDVLITFDVEGEGSAPSEEEAPEQPKAADNAKDVQDTDKKVEDKPNEVQI
HKSERVIAMPSVRKYAREKGVDIREVQGSGDNGRVVKEDIDAFANGGQSSTAPAAEEKAP
AAQASASKSEVKPYVAAQPELETREKIKGIRKAISKAMVNSKHTAPHVTLMDEVDVTNLV
ALRKNFKEVAAAQGTKLTYLPFVVKALTAAAKKYPAINASIDDVNEEVVYKNYFNIGIAA
DTDNGLVVPVVKDADRKSIFGLADNINDLAGKARDGKLSGDEMKGGSITITNIGSAGGQW
FTPVINHPEVAILGIGRIAEKAVVKNGEIVAAPVLALSFSFDHRLIDGATAQNALNLVKR
LLNDPQLLIMEG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtttatttgaattcaaattaccggatatcggtgagggtattcacgaaggtgaaatc
gtaaagtggttcgttaaagcaggcgacacagtaaaagaagatgacattcttcttgaagta
caaaacgataaagcagtcgttgaaatcccgtcaccagttgatggcacagtcaaagaagta
aaagtcgacgaaggcatcgtagccgtcgttggtgacgtattgatcacgtttgatgtggaa
ggcgaaggttcagctccttctgaagaagaagcaccggaacaacctaaagcagcagacaac
gcaaaagatgtccaagacacagataaaaaagtcgaagacaagccaaatgaagttcaaatc
cataaatcagaacgcgttatcgcaatgccttcagtgcgtaaatatgcacgcgaaaaaggc
gtcgacatccgtgaagttcaaggttctggtgacaacggtcgcgttgtcaaagaagacatc
gatgcatttgcaaacggtggacaatcttcaactgcaccagcagcagaagaaaaagcaccg
gcagcacaagcttcagcatctaaatctgaagtgaaaccgtatgttgcagctcaacctgag
ctcgaaacacgcgagaagatcaaaggaatccgtaaagcgatttcgaaagcaatggtcaac
tcgaaacatacagccccacacgttacattgatggacgaagtcgatgttacgaatcttgtt
gcactccgtaaaaacttcaaagaagttgcggcagcacaaggtacgaaattgacgtatctt
ccattcgttgtaaaagcattgactgctgcagctaaaaaataccctgcaatcaacgcgtca
atcgacgatgtgaacgaagaagttgtttacaaaaactacttcaacatcggtatcgcagca
gacacagacaatggtcttgttgttcctgtcgtcaaagatgcagaccgtaaatcaatcttc
ggattagcagataacattaacgaccttgctggtaaagcacgtgacggtaaactttctggg
gacgaaatgaaaggcggatcgatcacaatcacaaacatcggttctgctggcggacaatgg
ttcacacctgtcatcaaccacccagaagttgcaatcctcggtattggccgtatcgctgaa
aaagcggtcgtcaaaaacggtgaaatcgttgcagcaccagtacttgctttgtcattcagc
ttcgaccaccgtctcatcgatggtgctacagcacaaaacgcgcttaacttggttaaacgt
ctgttaaacgacccacaacttctcattatggagggataa

DBGET integrated database retrieval system