KEGG   Exiguobacterium sibiricum: Exig_2074Help
Entry
Exig_2074         CDS       T00687                                 

Gene name
alaS
Definition
alanyl-tRNA synthetase (EC:6.1.1.7)
Orthology
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
esi  Exiguobacterium sibiricum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:esi00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2024148..2026790)
Genome map
AA seq 880 aa AA seqDB search
MKPLKPLTGAQIRQMYLDFFQSKGHAIEPSASLVPIEDPTLLWINSGVATLKKYFDGRVI
PQNPRIVNAQKSIRTNDIENVGKTARHHTFFEMLGNFSVGDYFREDAIKWGWELLTSDEW
YGLDPDRLSVTIHPEDDAARQIWLELGVPAERIIPLEDNFWEIGEGPSGPNTEIFFDRGP
AFGDDPNDSELYPGGENERYLEIWNIVFSQYNHDGHGNYTELPRKNIDTGMGLERMASVM
QDVPTNFDTDLFMPIIHKTEEISGKRYREDTKLDVAFKVIADHIRTVAFAIGDGALPSNE
GRGYVLRRLLRRAVRYAKMLGIERPFMYELVDTVGSVMVDFYPQVPEKADFIKRVIKNEE
ERFHETLHDGLAILNTVAQAAKNNGEHIISGEDAFRLYDTYGFPLELTVEYAEDHQMSVD
EEGFKRAMDEQRKRARAAREDGGSMQQQSEVLATLTVPSQFVGYTDLEADAKIIALLHDG
ERVTEVAAGEEAQLLLDVTPFYAESGGEVADSGTITGPDFVLDVKDVQKAPNGQNLHTVV
VRTGIALADASVHAAVEASSRQAITKNHTATHLLHKALKDTLGTHVNQAGSLVSAERLRF
DFSHFGAVTAEELATIEQDVNQAIWASLAVEIEEMNIADAKAKGAMALFGEKYGETVRVV
SAGTYSIELCGGIHVRNTAEIGLFKIVSESGIGAGTRRIEAVTGAGAYHVMNGHLQTLEQ
AARVLKTKTTEVPGRIEALQVQLRETERAHESLQAKLANIEAASLKDDVEQINGVQVLAK
QVDVSDMDALRGMMDELKSSLGSAIIVLGSAQGDKVNLVASVSKDLIDQGYHAGKLIKEV
ATRCGGGGGGRPDMAQAGGKDPAKLNEALAFTSHYVQSLA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattaaaaccgttgacgggtgcacaaatccgtcaaatgtatctcgactttttc
cagtctaaagggcacgcaatcgaaccaagcgcatcactcgttccaattgaggatccgacg
ttactttggatcaactcgggtgtcgctacgttaaaaaaatattttgatggacgggtcatt
ccgcaaaatccacggattgtcaacgcacagaaatccatccggacgaacgatatcgaaaac
gtcgggaaaacagcacgtcaccatacgttttttgaaatgctcggaaacttttcggtcggc
gattacttccgcgaagatgcgatcaaatggggctgggaactcttgacgagtgacgagtgg
tacggtcttgatccggatcgtctttccgtaacgattcacccggaagacgatgctgcgcgt
caaatctggctcgaactgggtgtgccggctgagcgcatcatcccgcttgaagataacttc
tgggaaatcggggaaggtccttcaggtccgaacacggagattttcttcgaccgtggaccg
gctttcggcgatgatccgaacgactctgaactctatccgggcggcgagaacgaacggtac
cttgaaatctggaatatcgtattcagtcaatataatcatgacggacacggcaactataca
gaattaccgcgtaaaaacatcgataccggaatgggtcttgagcggatggcgagcgtcatg
caggacgtaccgacgaactttgatacggacttgttcatgccgatcatccacaaaacggaa
gaaatcagcgggaaacgttatcgcgaagacacaaaactggatgtcgcgttcaaagtcatc
gcggaccacatccgcacggttgcttttgccatcggagacggagcgttgccttcgaacgaa
ggacgcggttatgtcttacgccgattgcttcgtcgtgctgtccgttatgcaaaaatgctt
gggattgaacgtccgttcatgtacgaactcgttgatacagtcggcagcgtcatggtcgat
ttttatccgcaagttccggaaaaagcagatttcatcaaacgtgtcatcaaaaacgaggaa
gagcgattccacgagacattacatgacggtcttgccatcctgaacacagtggcacaagct
gccaaaaataacggcgaacatatcatcagcggagaagatgctttccgtttgtatgatacg
tacggtttcccgcttgaactgacggttgaatatgcggaagatcatcagatgtcggtcgat
gaagaaggatttaaacgggcgatggatgagcagcgtaaacgtgcccgtgctgcccgtgaa
gacggcggttcgatgcaacaacaatcagaagtattggcaactttgactgttccaagtcaa
ttcgttggttatacggaccttgaggcggatgcaaaaatcattgctttgttgcatgatgga
gaacgagtaacagaagtcgctgccggcgaggaagcacaattgttgcttgatgttacaccg
ttttatgcagagagcggcggagaagtggctgactcaggaacaatcacgggtccggatttc
gtcctcgatgtcaaagatgtccaaaaagcaccaaacggtcaaaatctgcataccgttgtg
gtccggacagggattgctttagcggatgcatccgttcatgccgcggtcgaagcatcgtcg
cgtcaagccatcacgaaaaaccatacggcaacccacttgttgcataaagcgttgaaagac
acactcggaacacacgtcaaccaagcgggttcacttgtttcagcggaacgtctgcgcttt
gacttctcgcacttcggagcagtaacggccgaagaattagcaacaatcgaacaggatgtc
aaccaagcgatttgggcatcacttgcagtcgaaattgaagagatgaacattgctgatgcg
aaagcaaaaggggcaatggcactgtttggtgaaaaatacggcgagacggttcgtgtcgtt
tcggctggaacctattcgatcgaactctgtggcgggattcacgtccgcaatacagcggaa
atcggtctgttcaagattgtttccgaatcaggcatcggagccggaacacgcaggattgaa
gctgttacaggagcaggcgcttaccatgtcatgaacggtcacctgcagacactcgagcag
gcagcacgtgtcctgaaaacgaaaacgacggaagtaccgggacgaatcgaagcacttcaa
gtccagcttcgcgaaacggaacgggcacacgaatcattgcaggcaaaacttgcaaacatc
gaagcggcgtcacttaaagatgatgtcgagcagatcaacggcgtccaggtgcttgcgaag
caagtcgacgtctcggatatggatgcccttcgcggcatgatggacgaactgaagtcaagt
ctcggttcggcaatcatcgtcctcggtagtgcgcagggagacaaagtcaacctcgttgcg
agtgtctcaaaagacttaatcgatcaagggtaccatgccggtaaattgatcaaggaagta
gccacacgttgcggcggcggtggtggcggtcgtccggacatggcacaggccggcggaaaa
gatcctgcaaaattaaacgaagctcttgcgtttacttcacattacgtgcaatcactggca
taa

DBGET integrated database retrieval system