KEGG   Exiguobacterium sibiricum: Exig_2074Help
Entry
Exig_2074         CDS       T00687                                 

Gene name
alaS
Definition
alanyl-tRNA synthetase (EC:6.1.1.7)
Orthology
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
esi  Exiguobacterium sibiricum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:esi00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Exig_2074 (alaS)
Enzymes [BR:esi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     Exig_2074 (alaS)
Amino acid related enzymes [BR:esi01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Exig_2074 (alaS)
Transfer RNA biogenesis [BR:esi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Exig_2074 (alaS)
 Prokaryotic Type
    Exig_2074 (alaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2024148..2026790)
Genome map
AA seq 880 aa AA seqDB search
MKPLKPLTGAQIRQMYLDFFQSKGHAIEPSASLVPIEDPTLLWINSGVATLKKYFDGRVI
PQNPRIVNAQKSIRTNDIENVGKTARHHTFFEMLGNFSVGDYFREDAIKWGWELLTSDEW
YGLDPDRLSVTIHPEDDAARQIWLELGVPAERIIPLEDNFWEIGEGPSGPNTEIFFDRGP
AFGDDPNDSELYPGGENERYLEIWNIVFSQYNHDGHGNYTELPRKNIDTGMGLERMASVM
QDVPTNFDTDLFMPIIHKTEEISGKRYREDTKLDVAFKVIADHIRTVAFAIGDGALPSNE
GRGYVLRRLLRRAVRYAKMLGIERPFMYELVDTVGSVMVDFYPQVPEKADFIKRVIKNEE
ERFHETLHDGLAILNTVAQAAKNNGEHIISGEDAFRLYDTYGFPLELTVEYAEDHQMSVD
EEGFKRAMDEQRKRARAAREDGGSMQQQSEVLATLTVPSQFVGYTDLEADAKIIALLHDG
ERVTEVAAGEEAQLLLDVTPFYAESGGEVADSGTITGPDFVLDVKDVQKAPNGQNLHTVV
VRTGIALADASVHAAVEASSRQAITKNHTATHLLHKALKDTLGTHVNQAGSLVSAERLRF
DFSHFGAVTAEELATIEQDVNQAIWASLAVEIEEMNIADAKAKGAMALFGEKYGETVRVV
SAGTYSIELCGGIHVRNTAEIGLFKIVSESGIGAGTRRIEAVTGAGAYHVMNGHLQTLEQ
AARVLKTKTTEVPGRIEALQVQLRETERAHESLQAKLANIEAASLKDDVEQINGVQVLAK
QVDVSDMDALRGMMDELKSSLGSAIIVLGSAQGDKVNLVASVSKDLIDQGYHAGKLIKEV
ATRCGGGGGGRPDMAQAGGKDPAKLNEALAFTSHYVQSLA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattaaaaccgttgacgggtgcacaaatccgtcaaatgtatctcgactttttc
cagtctaaagggcacgcaatcgaaccaagcgcatcactcgttccaattgaggatccgacg
ttactttggatcaactcgggtgtcgctacgttaaaaaaatattttgatggacgggtcatt
ccgcaaaatccacggattgtcaacgcacagaaatccatccggacgaacgatatcgaaaac
gtcgggaaaacagcacgtcaccatacgttttttgaaatgctcggaaacttttcggtcggc
gattacttccgcgaagatgcgatcaaatggggctgggaactcttgacgagtgacgagtgg
tacggtcttgatccggatcgtctttccgtaacgattcacccggaagacgatgctgcgcgt
caaatctggctcgaactgggtgtgccggctgagcgcatcatcccgcttgaagataacttc
tgggaaatcggggaaggtccttcaggtccgaacacggagattttcttcgaccgtggaccg
gctttcggcgatgatccgaacgactctgaactctatccgggcggcgagaacgaacggtac
cttgaaatctggaatatcgtattcagtcaatataatcatgacggacacggcaactataca
gaattaccgcgtaaaaacatcgataccggaatgggtcttgagcggatggcgagcgtcatg
caggacgtaccgacgaactttgatacggacttgttcatgccgatcatccacaaaacggaa
gaaatcagcgggaaacgttatcgcgaagacacaaaactggatgtcgcgttcaaagtcatc
gcggaccacatccgcacggttgcttttgccatcggagacggagcgttgccttcgaacgaa
ggacgcggttatgtcttacgccgattgcttcgtcgtgctgtccgttatgcaaaaatgctt
gggattgaacgtccgttcatgtacgaactcgttgatacagtcggcagcgtcatggtcgat
ttttatccgcaagttccggaaaaagcagatttcatcaaacgtgtcatcaaaaacgaggaa
gagcgattccacgagacattacatgacggtcttgccatcctgaacacagtggcacaagct
gccaaaaataacggcgaacatatcatcagcggagaagatgctttccgtttgtatgatacg
tacggtttcccgcttgaactgacggttgaatatgcggaagatcatcagatgtcggtcgat
gaagaaggatttaaacgggcgatggatgagcagcgtaaacgtgcccgtgctgcccgtgaa
gacggcggttcgatgcaacaacaatcagaagtattggcaactttgactgttccaagtcaa
ttcgttggttatacggaccttgaggcggatgcaaaaatcattgctttgttgcatgatgga
gaacgagtaacagaagtcgctgccggcgaggaagcacaattgttgcttgatgttacaccg
ttttatgcagagagcggcggagaagtggctgactcaggaacaatcacgggtccggatttc
gtcctcgatgtcaaagatgtccaaaaagcaccaaacggtcaaaatctgcataccgttgtg
gtccggacagggattgctttagcggatgcatccgttcatgccgcggtcgaagcatcgtcg
cgtcaagccatcacgaaaaaccatacggcaacccacttgttgcataaagcgttgaaagac
acactcggaacacacgtcaaccaagcgggttcacttgtttcagcggaacgtctgcgcttt
gacttctcgcacttcggagcagtaacggccgaagaattagcaacaatcgaacaggatgtc
aaccaagcgatttgggcatcacttgcagtcgaaattgaagagatgaacattgctgatgcg
aaagcaaaaggggcaatggcactgtttggtgaaaaatacggcgagacggttcgtgtcgtt
tcggctggaacctattcgatcgaactctgtggcgggattcacgtccgcaatacagcggaa
atcggtctgttcaagattgtttccgaatcaggcatcggagccggaacacgcaggattgaa
gctgttacaggagcaggcgcttaccatgtcatgaacggtcacctgcagacactcgagcag
gcagcacgtgtcctgaaaacgaaaacgacggaagtaccgggacgaatcgaagcacttcaa
gtccagcttcgcgaaacggaacgggcacacgaatcattgcaggcaaaacttgcaaacatc
gaagcggcgtcacttaaagatgatgtcgagcagatcaacggcgtccaggtgcttgcgaag
caagtcgacgtctcggatatggatgcccttcgcggcatgatggacgaactgaagtcaagt
ctcggttcggcaatcatcgtcctcggtagtgcgcagggagacaaagtcaacctcgttgcg
agtgtctcaaaagacttaatcgatcaagggtaccatgccggtaaattgatcaaggaagta
gccacacgttgcggcggcggtggtggcggtcgtccggacatggcacaggccggcggaaaa
gatcctgcaaaattaaacgaagctcttgcgtttacttcacattacgtgcaatcactggca
taa

DBGET integrated database retrieval system