KEGG   Exiguobacterium sibiricum: Exig_2075Help
Entry
Exig_2075         CDS       T00687                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:esi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Exig_2075
Enzymes [BR:esi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Exig_2075
DNA repair and recombination proteins [BR:esi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Exig_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 UvrD_C AAA_22 HHH_3 AAA Helicase_RecD AAA_16 NTPase_1 T2SSE DUF4088 AAA_28 DUF2075 AAA_5 AAA_12 TsaE AAA_29 AAA_23 UvrD-helicase NACHT KTI12 AAA_25
Motif
Other DBs
NCBI-ProteinID: ACB61527
JGI: Exig2075
UniProt: B1YJE6
Position
complement(2027111..2029336)
Genome map
AA seq 741 aa AA seqDB search
MEHPHQVVGRIKRVLFSSEEEAHSIVLMAIKEKNFELKETELVVTGTGVGIELGGTYQAF
GRLIDHPRFGKQLKAELIRRSVPMTKHAAVRFLTNGSFTGIGPKTAKNIVDALGEDAIDI
ILKDSKALDRVPGLKQKQADVIFSRLATLYGVDQLMLFLAPFDVTPKLAAKIYAAYEGDA
MARIRENPYSLMYEVSGIGFKTADQIASHLGLIGLHPERVAASIMHILEQEAGEGHAFAT
VESLLQRAPRLLGEDPGERLEQAIELLLTEDKVKLEEGCLYLPTIFYAEVRAAKELARVM
ANGSEQEVDVATILSAIGQLEERFGMEYAVQQREAIELAVKAPLMVLTGGPGTGKTTVIK
GILHALQEIHDWPLEKSQVKSGEVYPYVLVAPTGRAAKRLSEATDVPAMTIHRLLKYDGT
NFQLDEDQPIAGKVLIIDESSMIDIYLLSSLLRAVPNGMKILFVGDRDQLPSVGPGQVLA
DLMDTDGIPVVRLNVVHRQAEDSSILRLAHDLKNRVTSADLLAPLSDRRFYSLAPQESLR
GIAAFAEKALAKGYSKFDVQILAPTYRGQVGIDELNIVLQKVYNPEAPKKREVKQGTRIY
RSGDKILQLVNNAEENVYNGDIGEIVNIFFAKENVDKVDKIIARFDQTEVEYNRSDWDQF
THAYAITIHKAQGSEFPIVLMPVFFTGAFKHSRNLIYTAVTRAKASLLLFGDPRAFHKAS
QEEEPRRRTRLIERLGGMTKT
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggagcacccccatcaagtagtcggtcgtatcaaacgtgtgcttttttcctccgaagaa
gaagcccattccatcgtcctgatggcgatcaaggaaaaaaactttgaactaaaagaaacg
gagcttgtcgttacgggaaccggtgtcggaatcgaactcggcggaacgtatcaagcgttc
ggacggttgattgatcatccgcgatttggcaaacaactaaaagcagagttgatccggcgt
tcggtcccgatgacgaaacacgctgccgtccgttttttgacgaacggatcgtttaccggc
attggtccgaaaacagcgaaaaatatcgtcgatgcgctcggtgaagatgccattgacatc
atcttaaaggacagtaaagcactcgatcgtgtccccgggttaaaacagaagcaggcggat
gtcatcttcagccggctcgcgaccttatacggtgtcgatcaactgatgctttttttagca
ccgtttgatgtcaccccaaaactcgcagcaaagatttatgcagcgtacgaaggggatgcg
atggcgagaattcgtgaaaatccttattccttgatgtatgaggtcagtggaatcggtttt
aagacagccgaccaaattgcctcgcatctcggacttatcggactgcatccggaacgggtc
gcagcatccatcatgcatatactggagcaggaagcgggagaagggcatgcattcgcgacg
gtcgaatccctgttacagcgggcaccgcgtctactcggtgaggatccgggggaacgcctg
gaacaagccatcgagctgttgctgacggaagataaggtcaaactcgaagaaggttgtttg
tatctgccgacgattttctatgcggaagtccgggcggcaaaagagttggcccgtgtcatg
gcgaacggatccgagcaggaagtcgatgtggcgacaattttgtcagccatcggtcaactc
gaagaacggtttggtatggaatacgccgttcagcaacgggaggcgattgagcttgcggtc
aaggcaccgctgatggtcctgacgggcggacccggtacggggaagacgacggtcatcaaa
gggattttgcatgcgcttcaggaaatccatgattggccgcttgaaaaaagtcaggtcaag
tcaggcgaagtctatccgtatgtgctcgtcgcaccaaccggacgggcggccaaacggctg
tcggaagcaacggacgttccggcgatgaccattcaccgcttattaaaatatgacgggacg
aacttccagctggacgaagaccaaccgattgccggtaaagtactgatcatcgatgaatcg
tccatgatcgacatctatctgttatcgagtttgttacgggccgtgccaaacggcatgaag
attttattcgtcggcgaccgggaccagctgccgtcggtcggtccggggcaagtccttgcc
gacttgatggatacggacggtattccggtcgtccggctcaacgtcgtccatcggcaggcc
gaagattcctcgattctccggttggcccacgatttaaaaaaccgggtcacgtcagctgat
ttgctggcccctttatccgaccgtcgtttttattcgcttgctccgcaggaatcgttgcgc
ggtatcgcggcttttgcagaaaaagcactggcgaaaggatattcgaagtttgacgttcaa
attttagcgccgacgtaccgcggacaggtgggcatcgacgaattgaatatcgttctgcaa
aaagtctacaatccggaagcgccgaaaaaacgggaagtcaaacaggggacacggatttac
cggagcggagacaagattcttcagctcgtcaacaatgcggaagagaatgtctacaacggt
gacatcggtgaaatcgtcaatatcttctttgcgaaggagaacgtggataaagtcgataaa
atcattgcccggttcgatcagacggaagttgaatataaccggagtgactgggatcaattt
acgcatgcttacgcgattacgattcataaagcgcaaggatcggagtttccgattgtgttg
atgccggtctttttcaccggtgccttcaagcattcccggaatctcatctatacagccgtc
actcgggccaaagccagtctgctgttgttcggagatccccgtgccttccataaagcgtca
caagaggaagaaccgcgccggcggacacggctcattgaacggctcggcggtatgacaaag
acttga

DBGET integrated database retrieval system