KEGG   Exiguobacterium sibiricum: Exig_2089Help
Entry
Exig_2089         CDS       T00687                                 

Definition
(p)ppGpp synthetase I SpoT/RelA (EC:2.7.6.5)
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
esi  Exiguobacterium sibiricum
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:esi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2041963..2044161)
Genome map
AA seq 732 aa AA seqDB search
MTNKQIVNVEDLLARCVEYMTEAEVKDIERAYQFAKDEHEGQFRRSGEPYIIHPVQVAGI
LVDIGLDATTIVAALLHDVVEDTDITLEELTERFGADVAMLVDGVTKLGKIKYKSKREEL
AENHRKMFIAMAEDIRVILIKLADRLHNMRTLQHMVKEKQVQKAEETLEIFAPLAHRLGI
STIKWELEDISLRYINPQQYYRIVSMMKQKRTEREALVTSVIDEVNEVLEEVEIAAEVDG
RPKHIYSIYNKMQNSKKEFSEIYDLMAVRIIVDSIKDCYAVLGIIHTQYKPMPGRFKDYI
AMPKPNMYQSLHTTVIGPKGEPLEVQIRTRDMHFIAEYGIAAHWAYKEGKEQEAKSGFED
KIAHFREILELQKDTADAEEFMESVKVDFFSDMLYVFTPKGDVIELPKGSVPIDYAYRIH
TEIGHRTIGAKVNGRMVPIDYKLKTGDIIEIVTSKHSYGPSKDWLKICVSSQAKNKIRQW
FKRQQREENVSKGRELIEAEVKKLGFEPKDVINDKTLEDVTRKFNFGQEEDMYAAVGYHG
LTAAQVAHKLTEKLRKDKESKNLELNEAISEMKTFDRPKKQNPEGVRVKGIDNMLVRMSR
CCNPVPGDDIVGYITRGRGVSIHRSDCLNVIHEQNPERLLEVEWEHEGKTVKSYNVEIEI
SGFDRAGLLNDVLQSVSAMNTNIVAVSGKGDDSKQAKISMTIAIDNVNHLQKVVDRIKQI
SDVYAVHRVMMT
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaacaaatcgtaaatgtagaagaccttctcgctcgatgtgtggagtacatg
acagaggcagaagtcaaagatatcgaacgtgcctatcaattcgcaaaagacgagcatgaa
ggacaatttcgtcgatcgggtgaaccttatatcattcacccggttcaagtggctgggata
ctggtagatatcggactcgacgcgacgacgattgttgccgctcttcttcatgatgtcgtc
gaagacactgacattacgctggaagaactcacggaacgattcggagcagatgtcgcgatg
ctggtcgatggcgtgacgaaactcgggaagatcaaatacaagtccaaacgagaagaattg
gcagaaaatcaccggaagatgtttattgcgatggcagaagacatccgcgtgattttgatc
aagttagccgaccgcctgcacaacatgcggacgcttcaacatatggtcaaagagaaacaa
gtccaaaaagcagaagaaacgcttgaaatctttgcgccgctcgcgcatcgactcgggatt
tcgacgattaaatgggaactcgaagacatcagtctgcgttacatcaatccgcaacaatac
taccggattgtctcgatgatgaaacaaaagcggacggaacgcgaagcgctcgtcacgtct
gtcatcgatgaagtcaacgaagtactcgaagaagtcgagatcgcagccgaggtggatggt
cgtccgaaacatatctactcgatctacaacaagatgcagaactcgaaaaaagaattcagc
gaaatctatgatttgatggccgtgcgaatcatcgtcgactccatcaaggattgttacgcg
gttctcggaatcattcacacccaatacaaaccgatgccgggacgcttcaaggactatatc
gcgatgcctaaaccgaacatgtaccagtcgttgcatacaacggttatcgggccgaagggt
gaaccgcttgaagtgcaaattcggacacgcgatatgcatttcatcgccgaatacggaatt
gccgcacactgggcttacaaagaaggaaaagagcaagaggcgaagtcaggttttgaagat
aaaatcgcccacttccgtgaaattctggagttacaaaaagataccgccgatgcggaagaa
ttcatggagtcggtcaaagtcgacttcttcagcgatatgctgtacgtctttacaccaaag
ggtgacgtcatcgaattgccgaaagggtcggtgccgattgattatgcctaccggatccat
acggaaatcggacaccggacgattggagcaaaagtcaacggacggatggtgccgatcgat
tacaaactgaagaccggtgacatcattgaaatcgttacgtcgaaacacagttatggacca
agcaaggattggctcaagatttgtgtatcgagtcaggcgaaaaataaaatccgtcaatgg
ttcaaacggcaacaacgggaagaaaacgtctcgaaaggtcgggaactgattgaggcggaa
gtaaaaaaactcggctttgaaccaaaggatgtcatcaacgataagacacttgaggacgtg
acacggaagttcaacttcggtcaagaagaagatatgtatgctgccgtcggatatcacggt
ctgaccgctgcccaagtcgcgcataaattgacggaaaaattgcgcaaagacaaagagtca
aaaaatcttgaattaaacgaagccatcagtgaaatgaagacgtttgaccgaccgaagaaa
caaaatccggaaggcgttcgtgtcaaaggcatcgacaacatgctggtccgcatgagccgt
tgctgcaacccggttccgggtgatgatatcgtcgggtatattacccgcggtcgcggtgtt
tcgattcaccggtccgattgtctgaatgtgattcatgaacagaatccggaacggttgctt
gaagtcgaatgggaacatgaaggcaagacggtcaagagttataacgtcgaaatcgaaatt
tccggttttgaccgggcgggtctgttaaatgatgtcctccaatcggtgtccgcgatgaac
acgaatatcgtagctgtcagcggtaagggagacgacagcaaacaggccaagatttcaatg
acgatcgcaatcgacaacgtcaatcacctgcaaaaggtcgtcgatcgaattaaacaaata
tcagacgtgtatgccgtgcatcgcgtcatgatgacataa

DBGET integrated database retrieval system