KEGG   Exiguobacterium sibiricum: Exig_2212Help
Entry
Exig_2212         CDS       T00687                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00030  Pentose phosphate pathway
esi00051  Fructose and mannose metabolism
esi00052  Galactose metabolism
esi00680  Methane metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
esi01230  Biosynthesis of amino acids
esi03018  RNA degradation
Module
esi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
esi_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2212
   00030 Pentose phosphate pathway
    Exig_2212
   00051 Fructose and mannose metabolism
    Exig_2212
   00052 Galactose metabolism
    Exig_2212
  Energy metabolism
   00680 Methane metabolism
    Exig_2212
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Exig_2212
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Exig_2212
Protein phosphatases and associated proteins [BR:esi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Exig_2212
Messenger RNA biogenesis [BR:esi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Exig_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: ACB61664
JGI: Exig2212
UniProt: B1YKB1
Position
complement(2177138..2178106)
Genome map
AA seq 322 aa AA seqDB search
MSLKRIAILTSGGDAPGMNAAVRAVTRKAIFHGLEVFGVYNGYQGLINGDLVQLNLGSVG
DIIQRGGTFLRSARCPEFRTEEGRAKAVVNLKKFEIDALVVVGGDGSYRGAQKLTGLGFP
TIGLPGTIDNDIPGTDYTIGFDTALNTALEAIDKIRDTASSHERTYVIEVMGRDAGDIAL
YAGLAGGAESILVPERPEDLKEVLNRIQSGVNRGKKHSIVIVAEGAGRAQDVGDEIAKET
GLDTRVTVLGHVQRGGAPTAADRVLASRMGAYAIDILLEGKQGRVVGVRGGKMVDLDIDE
ALDENKHELDLEILELSKQLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttgaaacggattgctattttaacaagtggtggcgatgcacccggcatgaatgcc
gcagtgcgtgctgtaacacgtaaggcgatttttcatggactggaagtgtttggtgtctac
aacggataccaaggtctgattaacggagatctcgtccaattgaaccttggttcagtcggt
gacatcatccaacggggtggaacgttcctgcgttctgcacgttgcccggaattccggact
gaagaaggacgcgcgaaagctgtcgtcaatctgaagaaattcgaaatcgatgcactcgtc
gtcgttggtggtgacgggtcttatcgtggtgctcaaaaattgacgggactcggtttcccg
acgatcggtcttccgggaacgattgataacgacatcccgggtacggattacacgattggt
ttcgatacagccctcaatacggcactcgaagccatcgataagatccgtgacacggcgtcg
tcacatgagcggacatatgtcatcgaagtcatgggacgcgacgcaggggatatcgcacta
tatgctggattagccggcggagcggaatcaatcctggttccggaacgtccggaagattta
aaagaagtcttgaaccggattcaaagcggtgtcaatcgtggtaagaaacactcgatcgtt
atcgtagcggaaggtgccggacgtgcgcaggatgttggagacgagattgccaaggaaaca
ggacttgatacacgtgtcacggtattaggtcatgttcaacgcggcggtgcgccgacagct
gctgaccgtgtactggcaagccggatgggtgcctatgcgattgacatcctgcttgaaggt
aagcaaggacgtgtcgtaggtgtacgcggcggtaagatggtcgatcttgatatcgacgaa
gcattggatgaaaacaaacacgaactggatctcgaaatcttagagttgtcaaaacaacta
tccatctaa

DBGET integrated database retrieval system