KEGG   Exiguobacterium sibiricum: Exig_2212Help
Entry
Exig_2212         CDS       T00687                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Exig_2212
   01230 Biosynthesis of amino acids
    Exig_2212
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2212
   00030 Pentose phosphate pathway
    Exig_2212
   00051 Fructose and mannose metabolism
    Exig_2212
   00052 Galactose metabolism
    Exig_2212
  Energy metabolism
   00680 Methane metabolism
    Exig_2212
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Exig_2212
Protein phosphatases and associated proteins [BR:esi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Exig_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2177138..2178106)
Genome map
AA seq 322 aa AA seqDB search
MSLKRIAILTSGGDAPGMNAAVRAVTRKAIFHGLEVFGVYNGYQGLINGDLVQLNLGSVG
DIIQRGGTFLRSARCPEFRTEEGRAKAVVNLKKFEIDALVVVGGDGSYRGAQKLTGLGFP
TIGLPGTIDNDIPGTDYTIGFDTALNTALEAIDKIRDTASSHERTYVIEVMGRDAGDIAL
YAGLAGGAESILVPERPEDLKEVLNRIQSGVNRGKKHSIVIVAEGAGRAQDVGDEIAKET
GLDTRVTVLGHVQRGGAPTAADRVLASRMGAYAIDILLEGKQGRVVGVRGGKMVDLDIDE
ALDENKHELDLEILELSKQLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttgaaacggattgctattttaacaagtggtggcgatgcacccggcatgaatgcc
gcagtgcgtgctgtaacacgtaaggcgatttttcatggactggaagtgtttggtgtctac
aacggataccaaggtctgattaacggagatctcgtccaattgaaccttggttcagtcggt
gacatcatccaacggggtggaacgttcctgcgttctgcacgttgcccggaattccggact
gaagaaggacgcgcgaaagctgtcgtcaatctgaagaaattcgaaatcgatgcactcgtc
gtcgttggtggtgacgggtcttatcgtggtgctcaaaaattgacgggactcggtttcccg
acgatcggtcttccgggaacgattgataacgacatcccgggtacggattacacgattggt
ttcgatacagccctcaatacggcactcgaagccatcgataagatccgtgacacggcgtcg
tcacatgagcggacatatgtcatcgaagtcatgggacgcgacgcaggggatatcgcacta
tatgctggattagccggcggagcggaatcaatcctggttccggaacgtccggaagattta
aaagaagtcttgaaccggattcaaagcggtgtcaatcgtggtaagaaacactcgatcgtt
atcgtagcggaaggtgccggacgtgcgcaggatgttggagacgagattgccaaggaaaca
ggacttgatacacgtgtcacggtattaggtcatgttcaacgcggcggtgcgccgacagct
gctgaccgtgtactggcaagccggatgggtgcctatgcgattgacatcctgcttgaaggt
aagcaaggacgtgtcgtaggtgtacgcggcggtaagatggtcgatcttgatatcgacgaa
gcattggatgaaaacaaacacgaactggatctcgaaatcttagagttgtcaaaacaacta
tccatctaa

DBGET integrated database retrieval system