KEGG   Exiguobacterium sibiricum: Exig_2237Help
Entry
Exig_2237         CDS       T00687                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00620  Pyruvate metabolism
esi00640  Propanoate metabolism
esi00680  Methane metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2237
   00620 Pyruvate metabolism
    Exig_2237
   00640 Propanoate metabolism
    Exig_2237
  Energy metabolism
   00680 Methane metabolism
    Exig_2237
Enzymes [BR:esi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Exig_2237
Lipid biosynthesis proteins [BR:esi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Exig_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACB61689
JGI: Exig2237
UniProt: B1YKD6
Position
complement(2205480..2207183)
Genome map
AA seq 567 aa AA seqDB search
MKVLKALPGEHWLSEYDGSDSYDWQEAEQYFSWSTTGKVNMAYEAIDRHAEGERANKTAL
IYFDGTTEQTFTYADMKRLTNKAANVLKDAGIEAGDRIFIFMPRSPELYFALLGALKVGA
IVGPLFEAFMEQAVRDRLLDSEAKMLITTKALLPRVPVDELTSLEQIFLVDEDVEEDDKI
KDFRQAFQQASESFEPVWLDREDGLILHYTSGSTGKPKGVLHVQNAMIQHMMTGRWVLDL
QEDDVYWCTADPGWVTGTSYGIFAPFLNGATNVVVGGRFNPDFWYSVIEKYKVTVWYSAP
TAFRMLMGAGAEVANTHDLSSLRHVLSVGEPLNPEVIRWGKEAFDQRIHDTWWMTETGAM
MICNYKSMDIKPGSMGKPIPGTKAAIVDDQGNELPPFRMGNLALKTPWPSMMRQIWNNPQ
KYESYFFKGWYVSGDSAYMDDEGYFWFQGRVDDVIMTAGERVGPFEVESRLVEHPAVAEA
GVIGKPDPVRGEIIKAFISLRDGYEPTEELKQEIQKFVKEGLAAHAAPREIDFRDKLPKT
RSGKIMRRVLKAWELNLETGDLSTMED
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttgaaagcgcttccgggggagcattggttatccgaatatgatggttcagat
tcatatgattggcaagaagcggaacagtatttttcgtggtcgacgacggggaaagtcaac
atggcctacgaagcaatcgatcgtcatgcagaaggtgaacgtgccaataagacggcattg
atttattttgacgggacaacggaacagacgtttacgtatgccgatatgaaaagactgacg
aataaagcggcgaacgtcctgaaagacgcaggaatcgaagcgggagatcggattttcatt
ttcatgccacgttcaccggaattgtattttgccttactcggtgcgttgaaagtcggcgcg
attgtcggtccactattcgaagccttcatggagcaggcagtccgggatcgcctgctggat
tcggaagcaaaaatgctgattacgacaaaagccttattgccgcgtgttcctgttgatgag
ctgacatctctcgaacagattttcctggttgatgaagacgtcgaggaagacgataaaatc
aaggacttccgacaagcgtttcaacaagcatctgaatcgtttgagcctgtctggctggac
cgggaagatggtttgattcttcattatacatcgggttcgacgggtaaaccgaaaggcgtt
ttacatgttcaaaatgccatgatccaacatatgatgacaggacgatgggtgcttgatcta
caggaagacgacgtctactggtgtacggcagatccgggatgggtcacggggacaagctac
ggtatctttgcacctttcttaaacggtgcgacgaatgttgtcgtaggcggtcgctttaac
ccggacttctggtacagtgtcatcgagaaatataaagtaactgtgtggtacagcgcacca
actgctttccgaatgctgatgggagcaggggcggaagtcgccaatacacatgatttgtcc
agtttacggcatgtcctttccgtaggagaacctcttaatccggaagtcatccgctggggg
aaagaagcttttgatcaacggattcatgatacgtggtggatgacggagacaggggccatg
atgatctgtaactacaaatccatggatatcaaaccgggatcgatggggaaaccgattccg
ggaacaaaagcggctattgtagatgatcagggaaatgagttacctccgttccggatggga
aatttggcattaaaaacaccttggccgtcgatgatgcgccaaatttggaacaatccgcaa
aagtacgagtcgtatttctttaaagggtggtatgtatcaggggactcggcctatatggac
gatgaaggatacttctggttccagggtcgtgtcgatgatgtcatcatgactgccggagaa
cgtgttggaccattcgaagtggaaagccgcttagtcgagcatccggctgttgcagaagcg
ggtgtcatcgggaaaccggatccggttcgcggtgaaatcattaaagccttcatttcgctg
agagacggttatgagccgacagaagagctcaaacaagaaattcaaaagtttgtcaaagaa
ggattagccgcacatgctgctccgcgtgaaattgatttccgcgataaattaccgaaaaca
cgtagtggtaaaatcatgcgtcgtgttttaaaggcgtgggagctgaatcttgaaacggga
gatttgtcgacgatggaagactga

DBGET integrated database retrieval system