KEGG   Exiguobacterium sibiricum: Exig_2381Help
Entry
Exig_2381         CDS       T00687                                 

Definition
thermostable carboxylesterase Est30
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
esi  Exiguobacterium sibiricum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2342980..2343720)
Genome map
AA seq 246 aa AA seqDB search
MKITLPKPFFFEGGNRAVLLLHGFTGSSADVRMLGRYLQKHGYTSLAPQYKGHAAPPEEL
TKTGPADWWQDVLDGYEELKAKGYDEIAVCGLSLGGVMSLRLSMHRPVKAVIPMCAPAYI
KSEEVMYAGVTEYAREFKKREGKSAEEIEQEMAVFEPMPTLKDLQGLLKDTRDSLEDVYA
PTLVIQARNDHMINTDSANIIHDGVSALQKDLIWYENSGHVITLDKEKETLHQDIHEFLD
GLNWSH
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacattaccaaaaccattcttttttgaaggcggcaaccgggctgttctgttg
ttacacggctttaccggatcaagcgccgatgtccggatgctcggacgttacttgcaaaaa
cacggatatacttcactcgcaccacaatataaggggcacgctgccccacccgaagagctg
acgaagaccgggccagccgactggtggcaagatgttctcgatggctatgaagaattaaaa
gccaaaggatatgacgagattgccgtttgcggactgtcgctcggcggagtcatgtcgctt
cgactttcgatgcatcgtccggtcaaagcggtcattccgatgtgtgcgccggcttacatc
aaaagtgaagaggtcatgtatgcaggagtcacggagtatgcaagagaatttaagaagcga
gaaggaaaatcggcggaagaaatcgagcaggagatggcagtgttcgaaccgatgccgacc
ttaaaagatttgcaaggcttgctgaaagacacacgcgattcactcgaagatgtctatgca
ccgacgcttgtcatccaggcccgcaacgatcacatgatcaacaccgattcagcgaacatc
attcacgacggtgtcagtgccttacaaaaagatttgatctggtatgagaactcaggtcat
gtcattacgctcgacaaagaaaaagaaacgctccaccaagatatccatgaatttctggac
ggcttgaactggagccactaa

DBGET integrated database retrieval system