KEGG   Exiguobacterium sibiricum: Exig_2395Help
Entry
Exig_2395         CDS       T00687                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Exig_2395 (tpiA)
   01230 Biosynthesis of amino acids
    Exig_2395 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_2395 (tpiA)
   00051 Fructose and mannose metabolism
    Exig_2395 (tpiA)
   00562 Inositol phosphate metabolism
    Exig_2395 (tpiA)
Enzymes [BR:esi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Exig_2395 (tpiA)
Exosome [BR:esi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Exig_2395 (tpiA)
  Exosomal proteins of bladder cancer cells
   Exig_2395 (tpiA)
  Exosomal proteins of melanoma cells
   Exig_2395 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2355698..2356450)
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMNLTLKDAVAFAEEVKGTVPASSKVDAAVCAPSVFLAHLTEATAGTDLK
IGAQNMYDQESGAFTGEISPVMLKELGVTYVVLGHSERREYFGETDAFINSKTKKAFEHG
LVPIVCVGETLEEREGGKFESVIREQTTNSLKGLTVDQVKNLVVAYEPVWAIGTGKSATE
QDAQDSCKFVRDVIAAEFGTEAAEAVRIQYGGSVKPDNIKEYMAQPDIDGALVGGASLET
GSFLKLLEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaatcttaccctcaaggatgctgtg
gcattcgctgaggaagtcaaaggaactgtacccgcttcttcgaaagtcgacgcggctgtc
tgtgcaccgtctgtattccttgcacacttgacagaagcgacagctggaacggacctgaaa
atcggcgctcaaaacatgtacgaccaagagagcggcgcattcacaggtgaaatcagccca
gtgatgctcaaagaacttggcgtaacatacgtcgtcctcggtcactcagaacgtcgtgag
tactttggagaaactgatgcattcatcaacagcaaaacgaaaaaagcattcgagcatggt
ctcgtgccaatcgtttgtgtcggtgaaacactcgaagaacgcgaaggcggaaaattcgaa
tcagtgatccgtgaacaaacaacgaacagcttaaaaggtttgacagtcgatcaagtcaaa
aaccttgttgttgcatatgagcctgtctgggcaatcggaacaggaaaatcagcaacagaa
caagacgcacaagattcttgtaaattcgttcgcgatgtcatcgcagctgaattcggtacg
gaagctgcagaagcagtccgcatccagtacggcggtagtgtcaaaccggacaacatcaaa
gaatatatggctcagcctgacatcgacggtgctttagttggtggcgcaagtcttgagaca
ggatcgttcctcaaactcttggaggcgatttaa

DBGET integrated database retrieval system