KEGG   Exiguobacterium sibiricum: Exig_2721Help
Entry
Exig_2721         CDS       T00687                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
esi  Exiguobacterium sibiricum
Brite
Enzymes [BR:esi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Exig_2721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2708164..2708925
Genome map
AA seq 253 aa AA seqDB search
MMSMIYPVIPGAEAFSLGRGSVGILLCHGFNATPQSVRAVGEQFAAHGFSVYAPRLHGHG
TDLREFEATTADDWKQSVRDGFEQLAGRCESVFIVGQSMGATLALSLAAEGLPVAGIITI
NAALSVPAYEALSFTDCPVYLPESAPDIKQSAFEIIYDFVPAVCASELLRLIKETRSALA
AIQIPTLILYSAEDHVVPPVCSDYLYRTIGAADKRSYCLLDSYHVATLDHDQKTIVRETL
QFVEQFSRLTQTG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtatgatttatcctgttataccgggtgccgaagccttttccctaggacgcgga
tccgtcggcattttgctctgtcacggttttaatgcaacgccgcaaagtgttcgggctgta
ggagaacagttcgccgcacacggtttttccgtctatgcgccccgcctgcacgggcacggg
acggatctgcgggaattcgaagcaacgacggccgatgactggaagcagagtgtccgtgac
ggcttcgaacaattggctggtcggtgcgaatccgtcttcatcgtcggccaatcgatgggg
gcgacacttgccctgtcacttgccgctgaaggtctcccggtcgcaggaatcatcaccatc
aatgccgccttgtccgtccctgcctatgaagccttatcgttcaccgattgtccggtctat
ctgccggaaagtgcgcctgatattaaacagtcggcttttgaaatcatctatgatttcgtc
cccgctgtctgcgcttcggaactgttacgactgattaaggagacacggtcagcccttgcg
gcaattcaaattccgacacttattttatattctgccgaggatcatgtcgtgccgccggtc
tgttccgattatttgtaccggacgatcggtgcggcggataagcgcagttactgtctgctt
gactcctatcacgtcgcaacgcttgatcacgaccaaaagacgatcgtccgcgaaacactt
cagttcgtcgaacagttcagccggttgacacagaccggttga

DBGET integrated database retrieval system