KEGG   Exiguobacterium sibiricum: Exig_2729Help
Entry
Exig_2729         CDS       T00687                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
esi  Exiguobacterium sibiricum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Exig_2729
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Exig_2729
Enzymes [BR:esi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Exig_2729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2715661..2716908)
Genome map
AA seq 415 aa AA seqDB search
MDILHIVGQQRLEGTVMISGSKQSAIPCLAAALLTNQQVILEGVPDIGDVATMIQIIEML
GAVVTRQGDMVTIDPSHVEPMPLTGTDTRKLRGSIYLMSVLAARFKQGVVGLPGGYAIGP
RPIDLHIKALERLGVEMRNEQGVYYMNVEELKGNRIYLDLPSFGATISALLVAVMAEGTT
VIENAACDPEVIDVSTMLTNMGASVKGAGTDEIRIKGVETLQGCRHTLIPDRMEAGTFLA
MGAVLGRVTVDNVIPLHLESIIQKLERFGAKIELADDSVTASIDMAKPIDIRVFHYGGFP
SDLQPVISAVLLKPKGASVVVDKLYPQRFRHVQEMRRLNARITHEDASIIIRGGEALRGT
EIEAHDPRGAAALVLSGMLASGETLLHHAEVLDQSYERFDEKLKGLGALVWRETV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggacattttgcatatcgtaggacaacaacgtcttgaaggaaccgtcatgatcagtgga
tcgaaacagagtgcgattccgtgtctcgcggcagcactgctgaccaatcaacaggtcatt
cttgagggggtaccggacattggcgatgtcgcgacgatgatccaaatcattgagatgctt
ggagctgtcgtaacacgtcaaggcgatatggtgacgattgacccgagtcatgtcgaaccg
atgccgctcaccgggacggatacacgaaaattacgtggatccatttacctgatgagtgtt
ctcgcggcgcgattcaaacagggggtcgtcggtctgcccggtggttatgccatcggtcct
cgaccgattgatttacacatcaaggcactggaacgactcggtgtcgagatgcgaaatgaa
caaggggtttactacatgaacgtcgaagagttgaagggaaaccggatttatctggacctt
ccttcattcggtgcgaccattagtgccttgctggtcgctgtcatggcggaaggaacgacg
gtcattgaaaatgcagcgtgtgatccggaagtcatcgacgtgagtacgatgttgacgaac
atgggtgcgagtgtcaaaggtgcagggaccgatgagattcgaatcaaaggcgtcgagacg
cttcaaggatgccgtcatacgttaattccggaccggatggaagcagggacgttcctggca
atgggagccgtcctcggccgcgtgacggttgataacgtcattccgttacatcttgaaagc
atcattcaaaagttggaacggttcggggctaaaatcgagttggcggatgattcggtcaca
gcgtccatcgatatggcgaaaccgattgatattcgtgtctttcattacggaggatttccg
agtgatctgcaaccggtcatttcggctgtcctgttgaaaccgaaaggcgcaagtgtcgtc
gtcgacaagctgtatccgcaacgtttccggcatgtccaggaaatgcggcgcctgaatgca
cggattacccacgaagacgcttcaatcatcatccgcggcggtgaagcattgcgcggcact
gaaattgaagcccatgatccacgtggtgccgcggcactcgtgttaagtggaatgcttgct
tccggtgaaacgttattacaccatgcagaagtacttgatcaaagctacgaacggtttgac
gagaagttaaaaggactcggcgctcttgtttggcgcgaaacggtttaa

DBGET integrated database retrieval system