KEGG   Exiguobacterium sibiricum: Exig_2809Help
Entry
Exig_2809         CDS       T00687                                 

Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
esi  Exiguobacterium sibiricum
Pathway
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Exig_2809
Enzymes [BR:esi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Exig_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2795487..2796560)
Genome map
AA seq 357 aa AA seqDB search
MYRPTWIEIDREAIAHNVREIKARIGHQTMMAVVKADGYGHGAVTVAEIALANGADLLAV
ALLEEAIELREAGIQAPILMLETLLPEHAPIASNYDVAVPVFSADWLREAKQHLTDVDHL
RLHIKVDSGMGRLGLQTPEELDAVLQELDSDVMELEGIYTHFATADELNSRLFDEQQTVF
LHFVERVPDIRYIHAANSAGAIRLIGQDPFNVVRIGIALYGAMPSDEMIPYYEFLRPAFT
LKSRLMQVKQVEPGQTISYGATYTAPTDEWIGTVPIGYADGWSRKFQGYSLLVDGYPCEI
VGRVCMDRLMIRLPRNYPVGTEVTLIGQGVPIDEAAHWLGTINYEVLCQFSKRVPRI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaccaacttggatagaaattgaccgcgaagccatcgcgcacaatgtacgggaa
atcaaggcccgaatcggtcatcaaacgatgatggccgtcgtgaaggcggacggatacgga
catggtgccgtgacggtcgcggaaatcgcgttggcgaacggggcggatttactggctgtc
gccctgcttgaagaagcaatcgaattacgggaagccgggattcaggcaccgattttaatg
ctcgaaacgcttttgccggaacatgcaccgatcgcctcgaactatgacgtcgccgtgccg
gtgttttcagccgactggttgcgggaagcaaaacagcatttaacggatgtcgatcattta
cgactccacatcaaggttgacagcgggatgggccgtcttggactgcagacaccggaagag
ttggatgccgtcttacaagagttggattcggatgtcatggaactcgaaggaatctatacg
cattttgcgacagccgacgaattaaacagccggttgtttgacgagcaacagaccgttttc
ctgcatttcgtcgaacgcgtgccggatattcgatacatccatgcggccaactcagcgggc
gccatccgtttgatcggtcaggatccttttaatgtcgtccggatcgggattgccttatac
ggggcgatgccgtcagacgaaatgattccatattacgaattcttacgaccggcgttcacg
ctgaaaagtcgtctgatgcaggtcaagcaggttgaacccggtcaaacgatcagttacggt
gcgacctacacggcgccgacagatgagtggattggaacggtgccgatcggatacgcggac
ggctggtcccgcaagttccaggggtattcattacttgtcgacggttatccgtgcgaaatc
gtcggtcgggtctgtatggaccggttgatgatccgcttgccgcgcaattacccggttgga
acagaagtcacgttgattggacaaggtgtcccgattgatgaagcagcgcactggctgggg
acgatcaactatgaggtattgtgtcagttctcgaaacgggtcccgcgcatctag

DBGET integrated database retrieval system