KEGG   Exiguobacterium sibiricum: Exig_3005Help
Entry
Exig_3005         CDS       T00687                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00260  Glycine, serine and threonine metabolism
esi00680  Methane metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
esi01200  Carbon metabolism
esi01230  Biosynthesis of amino acids
Module
esi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
esi_M00002  Glycolysis, core module involving three-carbon compounds
esi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_3005
  Energy metabolism
   00680 Methane metabolism
    Exig_3005
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Exig_3005
Enzymes [BR:esi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Exig_3005
Membrane trafficking [BR:esi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Exig_3005
Exosome [BR:esi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Exig_3005
  Exosomal proteins of melanoma cells
   Exig_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACB62450
JGI: Exig3005
UniProt: B1YG66
Position
2993348..2993902
Genome map
AA seq 184 aa AA seqDB search
MKTYYVIRHCEATGQAHDAPLTKQGYKQADALTGFFKTIPVDRILSSPFRRAQETILPVA
ALQDCPVEIEDQLQERILSTSPLSDWCSALQETFVDFDLRFPGGESSREVMERMTSVLKE
ASLHPARHTVLVTHGNAMALLLHTIDSTFGYDDWQQLQNPDVYRLVQTADGMTCEQMTLH
QTKT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacatattatgtcatccgccattgcgaagcaaccggacaagcacatgatgctccg
ttgacgaaacaaggttacaaacaagcagacgcactcaccggttttttcaaaaccatccca
gtcgaccggattttatccagtccgttccgccgggcacaggaaacgattttacctgtcgcc
gctctccaggattgtccggttgaaatcgaggatcagctccaagaacgaatcctcagcacc
tcgccattaagcgattggtgttccgctttacaagaaacgttcgtcgatttcgatctccgc
tttcccggcggtgaatcgagtcgtgaagtgatggagcggatgacgtctgttctgaaagaa
gcatcgttgcatccggcccgtcatacggtgcttgtgacacatggaaacgcaatggcttta
ttgttgcacaccatcgattcaacctttggctacgatgactggcagcaattgcagaaccct
gatgtgtaccgtctcgttcagactgccgacgggatgacctgtgaacagatgacgcttcat
caaaccaaaacgtaa

DBGET integrated database retrieval system