KEGG   Exiguobacterium sibiricum: Exig_3005Help
Entry
Exig_3005         CDS       T00687                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
esi  Exiguobacterium sibiricum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Exig_3005
   01230 Biosynthesis of amino acids
    Exig_3005
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_3005
  Energy metabolism
   00680 Methane metabolism
    Exig_3005
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Exig_3005
Enzymes [BR:esi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Exig_3005
Exosome [BR:esi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Exig_3005
  Exosomal proteins of melanoma cells
   Exig_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2993348..2993902
Genome map
AA seq 184 aa AA seqDB search
MKTYYVIRHCEATGQAHDAPLTKQGYKQADALTGFFKTIPVDRILSSPFRRAQETILPVA
ALQDCPVEIEDQLQERILSTSPLSDWCSALQETFVDFDLRFPGGESSREVMERMTSVLKE
ASLHPARHTVLVTHGNAMALLLHTIDSTFGYDDWQQLQNPDVYRLVQTADGMTCEQMTLH
QTKT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacatattatgtcatccgccattgcgaagcaaccggacaagcacatgatgctccg
ttgacgaaacaaggttacaaacaagcagacgcactcaccggttttttcaaaaccatccca
gtcgaccggattttatccagtccgttccgccgggcacaggaaacgattttacctgtcgcc
gctctccaggattgtccggttgaaatcgaggatcagctccaagaacgaatcctcagcacc
tcgccattaagcgattggtgttccgctttacaagaaacgttcgtcgatttcgatctccgc
tttcccggcggtgaatcgagtcgtgaagtgatggagcggatgacgtctgttctgaaagaa
gcatcgttgcatccggcccgtcatacggtgcttgtgacacatggaaacgcaatggcttta
ttgttgcacaccatcgattcaacctttggctacgatgactggcagcaattgcagaaccct
gatgtgtaccgtctcgttcagactgccgacgggatgacctgtgaacagatgacgcttcat
caaaccaaaacgtaa

DBGET integrated database retrieval system