KEGG   Exiguobacterium sibiricum: Exig_3030Help
Entry
Exig_3030         CDS       T00687                                 

Definition
multi-sensor signal transduction histidine kinase (EC:2.7.13.3)
Orthology
K07652  
two-component system, OmpR family, sensor histidine kinase VicK [EC:2.7.13.3]
Organism
esi  Exiguobacterium sibiricum
Pathway
Two-component system
Module
VicK-VicR (cell wall metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:esi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Exig_3030
Enzymes [BR:esi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Exig_3030
Protein kinases [BR:esi01001]
 Histidine protein kinases
  OmpR family
   Exig_3030
Two-component system [BR:esi02022]
 OmpR family
  VicK-VicR [MD:M00459]
   Exig_3030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3013510..3015360)
Genome map
AA seq 616 aa AA seqDB search
MLKGTNFFKSIQWKLVVIYALLILVAMQVIGVYFVRSLEKQYITNFSKSVEDRAGLVAYN
VGKEFDKTGDDEASKRQLSESLGQLLSEFSSGSTSRNDILEVQIIDQDSIIQATSDEDNQ
SAVGQRATNSLIKKAQATSSSRVDTVLDPTTEDKIRIFAVPVTSERTGATTGMIYVRASM
ESIYSQMQQVTRILATGTVIALVITSILGVLLSRTITRPISDMRRQAIEMRRGNFSRKVK
VYSDDEIGQLARSFNELTDELLEANATTEAERRKLTSVLENMTDGVIATDRTLRVILMND
QAKDIVGVDESGIVGTNLKDLLALGDDFMIPEDGTMPPRLLDFSSEDELFLVRAFFSPVK
KHSGPITGMIIVLHDVTEQEQVEQDRREFVANVSHELRTPLTTMRSYLEALAEGAYQDEE
LAPRFLETTQNETERMIRLVTDLLQLSKMDSKEYKMNKVRFDYIQFLNDILDRHDMTKPE
RIRFRRKIMKRKVYIRGDQDKLIQVADNILTNAIKYSPEGGTITVRTMLRAKRIVISIKD
EGVGIPKANLQKIFERFYRVDKARARKIGGTGLGLSIAKDVVSAHGGDIWAESEWGRGTT
IYFTLPYEVIEEVDIG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggaacgaacttctttaaatcgatccagtggaagcttgtcgtcatttatgcg
ttgttgattttagtcgcgatgcaagtcattggggtttacttcgttcgttctcttgaaaaa
cagtacattacgaacttctcaaaatctgttgaagaccgggccggacttgtcgcgtacaat
gtcgggaaggaattcgataagacaggcgatgatgaggcctccaaacggcagttgtctgaa
tctcttggacagctgctgtctgagtttagtagtggctcgacgtcaaggaacgatattctc
gaagtacaaatcattgatcaggactcgatcattcaagcgacatccgacgaagacaatcag
tcagcggtcggacaacgggcaacaaattcactgataaaaaaagcacaggccacgagttcg
tctcgtgtcgataccgtccttgatccgacgacggaagacaagatccgcatctttgccgtc
cctgtcacctccgagcggaccggggcgacgaccggcatgatttatgtccgggcgtcgatg
gagtcgatctattctcaaatgcaacaagtcacacggatcttggcaacggggacagtgatt
gcacttgtcatcacctcgattctcggtgtcctgttatcgcggacaatcacccgtccgatt
tcggacatgcggcgtcaagcgatcgagatgcggcgcgggaacttctcgcggaaggttaaa
gtatattccgacgatgaaatcggtcagttggcacgttccttcaacgaactgacggatgaa
ttgctcgaagcgaacgcgacgacggaagccgagaggcggaaattgacgagcgtcctcgaa
aatatgacggatggcgtgattgcgacagaccggacattacgggttatcctgatgaacgac
caggcgaaggatatcgtcggtgtcgatgaatctggtatcgtcgggacgaacttaaaggat
ctcctcgcacttggagacgacttcatgattccggaagacggaacgatgccgccccgtctg
ctcgatttcagcagtgaggatgaactgttccttgtccgggccttcttctcgccggtcaaa
aagcacagtggtccgattaccgggatgatcatcgtcctgcatgacgtcacggagcaggaa
caggtcgagcaggaccgacgcgaattcgtcgcgaacgtcagccacgaactccggacaccg
ctgacgacgatgcggagttatctggaagccctggcggaaggcgcataccaggatgaagaa
ctggcacctcgtttccttgaaacgacacaaaacgaaacggagcggatgatccgcctcgtc
accgatctgttgcaactgtcgaaaatggacagcaaggaatataagatgaacaaagtccgc
tttgattacattcaattcttaaacgatattctggaccgtcacgatatgacaaaaccggaa
cggattcggttccggcgcaagatcatgaagcggaaagtctacatccgcggggaccaggat
aaattgatccaggtcgcggacaatatcctgacgaatgccatcaagtattcaccggaaggc
ggtacgattaccgttcggacgatgttacgggcaaaacgaatcgtcatcagcatcaaagat
gagggtgtcgggattccaaaagcgaacttacagaaaatctttgaacgtttctaccgggtc
gataaagcacgggcccggaagattggcggaaccggactcggtctctcgattgccaaagat
gtcgtttcggcgcatggcggtgacatttgggcagaaagcgaatggggacgcggcacgacg
atttactttacgcttccgtatgaggtgatcgaagaggtggatatcggatga

DBGET integrated database retrieval system