KEGG   Escherichia coli O104 H4 2011C-3493: O3K_00505Help
Entry
O3K_00505         CDS       T02257                                 

Definition
dihydrofolate reductase
Orthology
K18589  
dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
One carbon pool by folate
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    O3K_00505
   00670 One carbon pool by folate
    O3K_00505
Enzymes [BR:esl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     O3K_00505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85541..86014)
Genome map
AA seq 157 aa AA seqDB search
MKISLISATSENGVIGNGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSRKGISSSNENVLVFPSIEIALQELSKITDHLYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDINFPKIPENFNLVFEQFFLSNINYTYQIWKKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatttcattgatttctgcaacgtcagaaaatggcgtaatcggtaatggccctgat
atcccatggtcagcaaaaggtgagcagttactctttaaagcgctcacatataatcagtgg
ctccttgttggaaggaaaacatttgactctatgggtgttcttccaaatcgaaaatatgca
gtagtgtcgaggaaaggaatttcaagctcaaatgaaaatgtattagtctttccttcaata
gaaatcgctttgcaagaactatcgaaaattacagatcatttatatgtctctggtggcggt
caaatctacaatagtcttattgaaaaagcagatataattcatttgtctactgttcacgtt
gaggttgaaggtgatatcaattttcctaaaattccagagaatttcaatttggtttttgag
cagttttttttgtctaatataaattacacatatcagatttggaaaaaaggctaa

DBGET integrated database retrieval system