KEGG   Escherichia coli O104 H4 2011C-3493: O3K_01035Help
Entry
O3K_01035         CDS       T02257                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3K_01035
   00051 Fructose and mannose metabolism
    O3K_01035
Enzymes [BR:esl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     O3K_01035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203102..204424
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYINNFA
QMVDVLAGKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEATHKL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHNLSPV
HQSGRQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctattttgaccagctcgatcgcgttcgttatgaaggctcaaaatcctcaaac
ccgttagcattccgtcactacaatcccgacgaactggtgttgggcaagcgtatggaagag
cacttgcgttttgccgcctgctactggcacacattctgctggaacggggcggacatgttt
ggtgtgggggcgtttaatcgtccgtggcagcagcctggtgaggcactggcgttggcgaag
cgtaaagcagatgtcgcatttgagtttttccacaagttacatgtgccattttattgcttc
cacgatgtggatgtttcccctgagggcgcgtcgttaaaagagtacatcaataattttgcg
caaatggttgatgtcctggcaggcaagcaagaagagagcggcgtgaagctgctgtgggga
accgctaactgctttacaaaccctcgctatggcgcgggtgcggcgacgaacccagatcct
gaagtcttcagttgggcggcaacgcaagttgttacagcgatggaagcaacccataaattg
ggcggtgaaaactatgtcctgtggggcggtcgtgaaggttacgaaacgctgttaaatacc
gacttgcgtcaggagcgtgaacagctgggccgctttatgcagatggtggttgagcataaa
cataaaatcggtttccagggcacgttgcttatcgaaccgaaaccgcaagaaccgaccaaa
catcaatatgattacgatgccgcgacggtctatggcttcctgaaacagtttggtctggaa
aaagagattaaactgaacattgaagctaaccacgcgacgctggcaggtcactctttccat
catgaaattgccaccgccattgcgcttggcctgttcggttctgtcgacgccaaccgtggc
gatgcgcaactgggctgggacaccgaccagttcccgaacagtgtggaagagaatgcgctg
gtgatgtatgaaattctcaaagcaggcggtttcaccaccggtggtctgaacttcgatgcc
aaagtacgtcgtcaaagtactgataaatatgatctgttttacggtcatatcggcgcgatg
gatacgatggcactggcgctgaaaattgcagcgcgcatgattgaagatggcgagctggat
aaacgcatcgcgcagcgttattccggctggaatagcgaattgggccagcaaatcctgaaa
ggccaaatgtcactggcagatttagccaaatatgctcaggaacataatttgtctccggtg
catcagagtggtcgccaggagcaactggaaaatctggtaaatcattatctgttcgacaaa
taa

DBGET integrated database retrieval system