KEGG   Escherichia coli O104 H4 2011C-3493: O3K_04080Help
Entry
O3K_04080         CDS       T02257                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:esl01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:esl00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:esl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
835272..837443
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAVVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAALTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRHYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDELLTIPVAENANWSAQEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASL
ENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattgacgccaattttaaacgttttgtg
gatgaagaagttttaccgggaacagggctggacgctgcggcgttctggcgcaattttgat
gagatcgttcacgatctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccgcaaccggagcgcgtgacggtg
gaaaccacgggcattgacagcgaaatcaccagtcaggcggggccacagctggtggttccg
gcaatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcggtggtcagcggctacgatccg
caacgcggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatctctaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtaccccggcgcagtttgtcggttaccgt
ggcgatgccgctgcgctgacctgcattttgctgaaaaataacggcctgcatattgaactg
caaattgatgccaacgggcggattggcaaagacgatccggcgcacatcaacgatgttatc
gtcgaagctgctatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaatctgctgggcctgatgcaggggactctgcaagag
aaaatggagaaaaacggtcgacaaatcgtgcgtaaactgaatgacgatcgtcattacacc
gccgccgatggctctgaaatttctctgcacggacgctcgctgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactggcgcgatcgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgtcggacctcgctgaacttgcgtagctgtatcgct
caggcgcgcaatcgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgagcgtaataacgtgctttccggtctgttctgtgggctgcgcggt
aaagcgcaaattggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcaccaaccgct
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaagccaacatt
gcccagaccgagttcaatgctgaatttgaaccgctgctggacgagctgctgactattccg
gttgctgaaaacgctaactggtcggcgcaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgctgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaatgtggcgctgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacggtattctgaccaaagaacaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
gcggggaatttcgctaactcgtgtgcttttaaagctgccagcgatttaatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcctggcgtttacgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system