KEGG   Escherichia coli O104 H4 2011C-3493: O3K_10625Help
Entry
O3K_10625         CDS       T02257                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:esl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    O3K_10625 (ruvA)
Enzymes [BR:esl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     O3K_10625 (ruvA)
DNA repair and recombination proteins [BR:esl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     O3K_10625 (ruvA)
    RecFOR pathway proteins
     O3K_10625 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 HHH_3 HHH_8 LcrG
Motif
Other DBs
NCBI-GeneID: 13699655
NCBI-ProteinID: YP_006778820
UniProt: A0A0E0XZE4
Structure
PDB: 

Jmol
Position
2202419..2203030
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagagcgcacattgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcgctggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacatcacctgccagcccggcgaccgacgatgctgaa
caagaagcagttgccgcgctggtggcgctgggctataaaccacaagaggcaagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system