KEGG   Escherichia coli O104 H4 2011C-3493: O3K_13785Help
Entry
O3K_13785         CDS       T02257                                 

Definition
putative glucosyltransferase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O3K_13785
Enzymes [BR:esl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     O3K_13785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2836997..2838676)
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILELVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLITLR
RSHNEFHPDNNFTIDTINSSVMRIQRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISE
VDILGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagc
aatgatttaaaaccattacccacatttaatcagttttaccatcaatggctgcaaagcatt
ttttcacatgttcatttgttgccgttttatccatggtcatctgatgatggcttttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcatccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttgctggcgatggtggatgttttactctgttaccttgcg
aaaggtgctgagtatgtccgcctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgttgcgccaggtacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgcaggcgatgacgaagcacatatggtgtaccagttctcgctgccgcca
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggctaaacccgctacggggcttgttgcctgaaagcgaaatattagagctggtcgaggcg
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacacgcagtccg
tatgaaataaatgtgacctatatggatgcgttaagccgccgtgagagtagcgatgaagaa
cgttgcgccaggtttattctcgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattcttggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaatatcacagtaaagagataacccgagaactgaac
gatgaagctacattaaggcatgcggtatatcatgagttgtcgcgtttaattacacttcgt
cgcagccataacgagtttcatccggataataattttaccattgatacgattaattcatcc
gtaatgcgtattcaaagaagtaacgctgatggtaattgtctgactggattgtttaatgtc
agtaaaaatattcagcatgtaaatattactaatctgcatggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system