KEGG   Escherichia coli O104 H4 2011C-3493: O3K_14045Help
Entry
O3K_14045         CDS       T02257                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00260  Glycine, serine and threonine metabolism
esl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01130  Biosynthesis of antibiotics
esl01230  Biosynthesis of amino acids
Module
esl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3K_14045 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3K_14045 (trpA)
Enzymes [BR:esl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     O3K_14045 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 13702525
NCBI-ProteinID: YP_006779495
UniProt: A0A0E0Y1A8
Structure
PDB: 

Jmol
Position
2889633..2890439
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLVALKVFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcattgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccactctgcgcgcttttgcggcaggtgtgactccggcacaa
tgttttgaaatgctggcactgattcgccagaaacacccgaccattcccattggcctgttg
atgtatgccaatctggtgtttaacaaaggcattgatgagttttatgcccagtgcgaaaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagttgaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcacgagca
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcacctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggtggcactgaaagtttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system