KEGG   Escherichia coli O104 H4 2011C-3493: O3K_14615Help
Entry
O3K_14615         CDS       T02257                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00900  Terpenoid backbone biosynthesis
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01130  Biosynthesis of antibiotics
Module
esl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3K_14615 (ipk)
Enzymes [BR:esl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     O3K_14615 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 13700979
NCBI-ProteinID: YP_006779604
UniProt: A0A0E0Y038
Structure
PDB: 

Jmol
Position
2990081..2990932
Genome map
AA seq 283 aa AA seqDB search
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLIKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNY
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacagtggccctctccggcaaaacttaatctgtttttatacattaccggtcag
cgtgcggatggttaccacacgctgcaaacgctgtttcagtttcttgattacggcgacacc
atcagcattgagcttcgtgacgatggggatattcgtctgttaacgcccgttgaaggcgtg
gaacatgaagataacctgatcgttcgcgcagcgcgattgttgataaaaactgcggcagac
agcgggcgtcttccgacgggaagcggtgcgaatatcagcattgacaagcgtttgccgatg
ggcggcggtctcggcggtggttcatccaatgccgcgacggtcctggtggcattaaattat
ctctggcaatgcgggctaagcatggatgagctggcggaaatggggctgacgctgggcgca
gatgttcctgtctttgttcgggggcatgccgcgtttgccgaaggcgttggtgaaatacta
acgccggtggatccgccagagaagtggtatctggtggcgcaccctggtgtaagtattccg
actccggtgatttttaaagatcctgaactcccgcgcaatacgccaaaaaggtcaatagaa
acgttgctaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggtgctttcctggctgttagaatacgccccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctgaagcccgccaggtgctagagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgttaatctttccccattgcacaga
gccatgctttaa

DBGET integrated database retrieval system