KEGG   Escherichia coli O104 H4 2011C-3493: O3K_20855Help
Entry
O3K_20855         CDS       T02257                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    O3K_20855
Enzymes [BR:esl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     O3K_20855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4292713..4293192
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttgccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacctcaacgccgccgtggcg
cttgaaacttcgctcgccccggaagagttactcaaccatacacagcgcatagaactgcaa
cagggtcgtgttcgtaaagctgaacgctggggaccacgcacgctggatctcgatatcatg
ctgtttggtaatgaagtgataaataccgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgagattgcaccggagctggcgtttcctgat
ggggagacgttgcgtgaagtcttacatacaagagcatttgacaaattaagcaaatggtaa

DBGET integrated database retrieval system