KEGG   Escherichia coli O104 H4 2011C-3493: O3K_21520Help
Entry
O3K_21520         CDS       T02257                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
esl00260  Glycine, serine and threonine metabolism
esl00750  Vitamin B6 metabolism
esl01100  Metabolic pathways
esl01110  Biosynthesis of secondary metabolites
esl01120  Microbial metabolism in diverse environments
esl01230  Biosynthesis of amino acids
Module
esl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3K_21520
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    O3K_21520
Enzymes [BR:esl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     O3K_21520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 13703550
NCBI-ProteinID: YP_006780968
UniProt: A0A0E0Y5Q3
Structure
PDB: 

Jmol
Position
complement(4445515..4446801)
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcacaacgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgttttttccgcatgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtgcgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatgctgacccat
attgcgggcgataagccagtgaccattctgaccgcgacctccggtgataccggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacgttgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggttaaactcagctaactcgattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcacgacggtcagtggtcacccaaagcgactcaggcgacgttatccaacgcg
atggacgtgagtcagccgaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctgggttatgcagccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctacacctcggagccgcacgctgccgtagcgtatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcacataatctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system