KEGG   Escherichia coli O104 H4 2011C-3493: O3K_22150Help
Entry
O3K_22150         CDS       T02257                                 

Definition
ribokinase sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    O3K_22150
Enzymes [BR:esl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     O3K_22150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4575579..4576499
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCKLIVLQLEVQLETVYHAIEFGKKNGIEVLLNPAPALRELDMSYACKCDF
FIPNETELEILTGMSVDTYDHIRLAARSLVDKGLNNIIVTMSEKGALWMTRDQEVHVPAF
KVNAVDTSGAGDAFIGCFSHYYVQSGDVEAALKKAALFAAFSVTGKGTQSSYPSIEQFNE
FLTLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcagttattggttccaatatggtggatctcattacttacactaatcagatg
cctaaagaaggagaaactctggaagcacctgccttcaaaatcggatgtggtgggaaaggt
gctaatcaagcggtggcggcggctaaattgaattcaaaagtcctgatgctgactaaagta
ggtgatgatatttttgcggataatactattcgtaatcttgaatcatggggaattaatacc
acttatgttgagaaggtcccctgtaccagcagtggtgttgcaccgatctttgttaatgcc
aactcgagcaatagtatattaataattaagggagcgaataaatttctttccccggaagat
atcgatcgagctgcagaagatctgaaaaaatgcaaattgatcgttttacaactggaagtt
caactggaaacagtttaccacgcgattgagtttggtaagaaaaatggtattgaagtgtta
ttaaatccggctccggcattgcgtgagttagatatgtcttatgcctgcaaatgtgatttc
tttatcccgaatgaaacagaactggaaatattaaccggtatgtcggttgatacttatgat
catattcgtttggccgcacgttcgttagttgataaagggctgaacaatattattgttacc
atgagcgaaaaaggcgcattatggatgacccgcgatcaggaagtccatgttcctgcattc
aaagtaaatgctgttgatactagtggcgctggtgacgcatttattggttgcttttcccat
tattatgttcaaagcggtgatgttgaagccgctttgaaaaaagccgctctctttgccgct
ttcagcgtcacagggaaaggtacgcaatcatcttatccgagtattgaacaatttaatgaa
tttttaaccttaaacgaataa

DBGET integrated database retrieval system