KEGG   Escherichia coli O104 H4 2011C-3493: O3K_23810Help
Entry
O3K_23810         CDS       T02257                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:esl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3K_23810
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3K_23810
   00630 Glyoxylate and dicarboxylate metabolism
    O3K_23810
Enzymes [BR:esl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     O3K_23810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4925178..4926779)
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFIRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASIRDTDWKIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLNKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDVPITADQLLAPCDGECTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcataaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgcaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaactttgcctgattttatttcggaaacagcttccattcgcgatacggactggaaaatt
cgtggtattcccgcggacttacaagatcgtcgagtcgagataactggcccggttgagcgc
aagatggtgatcaacgcactgaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggcaccagactggaacaaagtgatcgacgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctataccaatgaagcaggcaaaatttatcagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggtagcctgtttgattttgcgctctatttcttccacaactatcag
gcactgttggcaaagggcagcggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagctatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaaccattcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggcatggcagcgtttattccgagcaaagatgaagag
cgcaataaccaggtgctcaacaaagtaaaagcggataaagcgctggaagccaataacggt
cacgatggcacatggattgctcacccaggccttgcggatacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgtgccgatt
actgccgatcagctgctggcaccttgtgatggtgaatgcaccgaagaaggtatgcgcgcc
aacattcgcgtggcagtgcagtacatcgaagcatggatctccggcaacggctgcgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcaatctggcag
tggatccatcatcaaaaaacgttgagcaatggcaaaccggtgaccaaagccttgttccgc
cagatgctgggtgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttgacgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system