KEGG   Escherichia coli O104 H4 2011C-3493: O3K_24730Help
Entry
O3K_24730         CDS       T02257                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
esl  Escherichia coli O104:H4 2011C-3493
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:esl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5137511..5138533)
Genome map
AA seq 340 aa AA seqDB search
MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVIC
PGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLADPHLGHVNRFNDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQI
LNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHW
VRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVI
KGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaaagactgggaaacaagagaaaacgcgtttgctgcttttaccatg
ggaccgctgactgatttctggcgtcagcgtgatgaagcagagtttactggtgtggatgac
attccggtgcgctttgtccgttttcgcgcacagcaccatgaccgggtggtagtcatctgc
ccggggcgtattgagagctacgtaaaatatgcggaactggcctatgacctgttccatttg
gggtttgatgtcttaatcatcgaccatcgcgggcagggacgttccggtcgcctgttagcc
gatccgcatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggcattc
tggcagcaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcgatg
ggcggtgcgatctccacattatttctgcaacgccatccaggtgtatgtgacgccattgcg
ctaactgcgccaatgtttgggatcgtgattcgtatgccgtcatttatggcacggcagatc
ctcaactgggccgaagcgcatccacgtttccgtgatggctatgcaataggcaccgggcgc
tggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcgacgt
aacttacgcttctatgctgatgacccaacgattcgcgtcggtgggccgacctaccattgg
gtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgccacg
ccaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcatgaccgt
ttttgtgaactccgcaccgccgcgggccatcctgtcgaaggaggacggccgttggtaatt
aaaggtgcttaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccac
gccatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagaggtt
taa

DBGET integrated database retrieval system