KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_00695Help
Entry
O3M_00695         CDS       T02316                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:esm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121124..121933
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLL
LELPEGWIIIHLGMSGSLRILPEELPPEKHDHVELVMSNGKVLRYTDPRRFGAWLWTKEL
EGHNVLTHLGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccgcggcatagaaccgcatctcgttggt
gcaaccattcttcatgcagtggtgcgcaacggacgcttgcgctggccggtttcagaagag
atctaccgtttaagcgaccaaccagtgcttagcgtgcagcggcgggctaaatatctgctg
ctggagctgcctgagggctggattatcattcatttagggatgtctggcagcctgcgcatc
cttccagaagaacttccccctgaaaagcatgaccatgtggaattggtgatgagcaacggc
aaagtgctgcgctacaccgatccgcgccgctttggtgcctggctgtggaccaaagagctg
gaagggcataatgtgctgacccatcttggaccggagccgcttagcgacgatttcaatggt
gagtatctgcatcagaagtgcgcgaagaaaaaaacggcgattaaaccgtggctgatggat
aacaagctggtggtaggggtagggaatatctatgccagcgaatcactgtttgcggcgggg
atccatccggatcggctggcgtcatcactgtcgctggcagagtgtgaattgttagctcgg
gtgattaaagcggtgttgctgcgttcgattgagcagggtggtacaacgctgaaagatttt
ctgcaaagtgatggtaaaccgggctatttcgctcaggaattgcaggtttacgggcgaaaa
ggcgagccgtgtcgggtgtgcggtacgccgattgtggcgactaaacatgcgcagcgggca
acgttttattgtcggcagtgccagaagtaa

DBGET integrated database retrieval system