KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_09995Help
Entry
O3M_09995         CDS       T02316                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    O3M_09995
Enzymes [BR:esm01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     O3M_09995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2089432..2090418
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPNAQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggctggagtttatcggcgcgccaactccg
ctcgaatatctgccgcgcttttctgattatcttggacgggaaattttcatcaaacgggat
gacgtcacccccatggcaatgggcggcaataaattacgtaagctggaatttctcgcagca
gatgctctgcgcgaaggtgccgatacgctgattactgccggggcgatccagtctaaccat
gtgcgccagactgccgcagttgcggcgaaactcggtctgcactgcgtggcgctgctggaa
aatcctattggcacaaccgcagaaaactatttaaccaacggcaatcgtttgttgctggat
ctgttcaatacccagattgaaatgtgtgacgcactgaccgatcccaatgcccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctctgggcgcgctgggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcggttaatatttcgtcggtggtggtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacaccttatgcctgaaagcgaactgattggcgttaccgtg
tcgcgttccgttgccgatcaattgccgaaagtggttaacctacaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattttactctgggatgactattttgcacctggc
tacggcgtgccgaacgatgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcggggctgattgacggtatcagt
cagaaacgcttcaaagatgaagggccgattctgtttattcataccggcggcgcgcctgcg
ctgttcgcctatcatccccacgtttag

DBGET integrated database retrieval system