KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_11030Help
Entry
O3M_11030         CDS       T02316                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3M_11030
Enzymes [BR:esm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     O3M_11030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2276274..2277158)
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttgagcaacaacacaccgttcaaaaatggcgtcgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggcggcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggcgtagcgctgacttttgaa
ttgacgcaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccgcgtgggtaaaacctgtgaaatcgatcttgaatcacatggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtgggctg
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtgatt
aatgatgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgtc
ggctggaacccgggaccggcgctttcagttagcatgggcgacatgccggatgatggctac
aaaacatttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtgaccaaagag
aaacctgcacatctggcgcaatccattcgcgttgcgaaacgttaa

DBGET integrated database retrieval system