KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_11090Help
Entry
O3M_11090         CDS       T02316                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    O3M_11090
Enzymes [BR:esm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     O3M_11090
    3.5.1.-  
     O3M_11090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2288480..2289121)
Genome map
AA seq 213 aa AA seqDB search
MPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLNQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtaccggaaggtgacagtacggtggaggttgctaaccgccttattgactggtgc
cagtcgcgcggagaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccaggccaactcgacggtttgccacaa
accttctggccagatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aaccaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaacctctctcgatgactggttacgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtgaacgtgattaccgatggttgtcgtggc
gtgaatatccagccccaggacagtgcacacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagagacacaggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system