KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_18010Help
Entry
O3M_18010         CDS       T02316                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
esm00020  Citrate cycle (TCA cycle)
esm00190  Oxidative phosphorylation
esm00650  Butanoate metabolism
esm01100  Metabolic pathways
esm01110  Biosynthesis of secondary metabolites
esm01120  Microbial metabolism in diverse environments
esm01130  Biosynthesis of antibiotics
esm01200  Carbon metabolism
Module
esm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
esm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
esm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3M_18010 (sdhD)
   00650 Butanoate metabolism
    O3M_18010 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    O3M_18010 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFS58270
Structure
PDB: 

Jmol
Position
complement(3667342..3667689)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVVFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcgtttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system