KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_24780Help
Entry
O3M_24780         CDS       T02316                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3M_24780 (hemD)
Enzymes [BR:esm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     O3M_24780 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5143454..5144194
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPDYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDTLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
MVVVTSGEMLQQLWSLIPQWYREHWLLHCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccgtctcccgctggagaagagttagtgagccgtctgcgc
acactggggcaggtggcctggcattttccgctgattgagttttctccgggtcgacaatta
ccgcaacttgctgatcaactggcggcgctgggggagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctgcatcagcaagatcgtaaatggccccga
ctacctgattatttcgccattggacgcaccaccgcactggcgctacataccgtaagcgga
cagaagattctctacccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaacgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggataccctgacagcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
atggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacactgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

DBGET integrated database retrieval system