KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_24980Help
Entry
O3M_24980         CDS       T02316                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:esm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    O3M_24980
Enzymes [BR:esm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     O3M_24980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(5193545..5194474)
Genome map
AA seq 309 aa AA seqDB search
MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV
PGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IDAFLDRQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgcaggcagcctcgttgttcttggcagcattaatgctgaccacattcttaat
cttcaatcttttcctactccaggcgaaaccgtaaccggtaaccactatcaggttgcattt
ggcggcaaaggcgcgaatcaggctgtggctgctgggcgtagcggtgcgaatatcgcgttt
attgcctgtactggcgatgacagcattggcgagagcgttcgccagcagctcgccactgat
aacatcgatattactccggtcagcgtgatcaaaggcgaatcaacaggtgtggcgctgatt
tttgttaatggcgaaggtgagaatgtcattggtattcatgccggcgctaatgctgccctt
tccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcgtcagcattattaatg
cagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatcgcccatcaaaataag
actatcgttgcgcttaacccggctccggctcgcgaacttcctgacgaactgctggcgctg
gtggacattattacgccaaacgaaacggaagcagaaaagctcaccggtattcgtgttgaa
aatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaaggtatccgtactgta
ctgattactttaggaagtcgtggtgtatgggctagcgtgaatggtgaaggtcagcgcgtt
cctggattccgggtgcaggctgtcgataccattgctgccggagatacctttaacggcgcg
ttaatcacggcgttgctggaagaaaaaccattgccagaggcgattcggtttgcccatgct
gccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgtaccgtggcgtgaagag
atcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system