KEGG   Escherichia coli O104 H4 2009EL-2050: O3M_25160Help
Entry
O3M_25160         CDS       T02316                                 

Definition
cryptic phospho-beta-glucosidase B
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
esm  Escherichia coli O104:H4 2009EL-2050
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:esm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5233191..5234585
Genome map
AA seq 464 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWQEDGKGISTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEVEPNEAGLAFYDRLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHEP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLLPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDSVGLRVLLNTLWDRYQKPLFIV
ENGLGAKDSVEADGSIQDDYRIAYLNDHLVQVNEAIADGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggcgcaacagctgccaatcaggtggaa
ggtgcctggcaggaagatggcaaagggatctcgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaattttccctcagggcgacgaagtcgaaccgaatgaa
gcggggttagcgttttacgatcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgagcggtcatcgatcacttcgagcattacgcccgcacggtctttactcgctac
caacataaagtggcgttatggctgacgtttaatgaaatcaacatgtcgttacacgagcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggctatccac
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgctccccgaagcg
aaaatcggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggccagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacataccgtcgatttcatctcttttagttattac
atgactggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatccccaatccgcatctgaaaagttcagagtgggggtggcaaattgattcggtt
ggattacgggttctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagcggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattgccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggcgaaggaagcctc
acaagaacgcgtaagaaaagcttcggatggtatgcagaagtgatcaaaacgcgggggctg
tcattaaaaaaataa

DBGET integrated database retrieval system