KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_00100Help
Entry
O3O_00100         CDS       T02256                                 

Definition
cryptic phospho-beta-glucosidase B
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_00100
Enzymes [BR:eso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     O3O_00100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5292619..5294013
Genome map
AA seq 464 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWQEDGKGISTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEVEPNEAGLAFYDRLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHEP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLLPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDSVGLRVLLNTLWDRYQKPLFIV
ENGLGAKDSVEADGSIQDDYRIAYLNDHLVQVNEAIADGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggcgcaacagctgccaatcaggtggaa
ggtgcctggcaggaagatggcaaagggatctcgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaattttccctcagggcgacgaagtcgaaccgaatgaa
gcggggttagcgttttacgatcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgagcggtcatcgatcacttcgagcattacgcccgcacggtctttactcgctac
caacataaagtggcgttatggctgacgtttaatgaaatcaacatgtcgttacacgagcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggctatccac
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgctccccgaagcg
aaaatcggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggccagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacataccgtcgatttcatctcttttagttattac
atgactggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatccccaatccgcatctgaaaagttcagagtgggggtggcaaattgattcggtt
ggattacgggttctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagcggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattgccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggcgaaggaagcctc
acaagaacgcgtaagaaaagcttcggatggtatgcagaagtgatcaaaacgcgggggctg
tcattaaaaaaataa

DBGET integrated database retrieval system