KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_00700Help
Entry
O3O_00700         CDS       T02256                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00071  Fatty acid degradation
eso00280  Valine, leucine and isoleucine degradation
eso00281  Geraniol degradation
eso00310  Lysine degradation
eso00362  Benzoate degradation
eso00380  Tryptophan metabolism
eso00410  beta-Alanine metabolism
eso00640  Propanoate metabolism
eso00650  Butanoate metabolism
eso00903  Limonene and pinene degradation
eso00930  Caprolactam degradation
eso01040  Biosynthesis of unsaturated fatty acids
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
eso01212  Fatty acid metabolism
Module
eso_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    O3O_00700 (fadB)
   00650 Butanoate metabolism
    O3O_00700 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    O3O_00700 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    O3O_00700 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3O_00700 (fadB)
   00310 Lysine degradation
    O3O_00700 (fadB)
   00380 Tryptophan metabolism
    O3O_00700 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3O_00700 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3O_00700 (fadB)
   00281 Geraniol degradation
    O3O_00700 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3O_00700 (fadB)
   00930 Caprolactam degradation
    O3O_00700 (fadB)
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     O3O_00700 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     O3O_00700 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     O3O_00700 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     O3O_00700 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFS83933
Position
5156604..5158793
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggcgcaaaggcggtt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccactaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacagcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgcggtgctgggt
gcaggcattatgggcggcggcatcgcttaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
atccacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gtcgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcggaatgcacttttttaacccggtacaccggatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggcctatgggtccggcatatctg
ctggatgtcgtgggcattgataccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgaagacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaggaaggcattatcgccactccggcggaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcctccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system