KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_01850Help
Entry
O3O_01850         CDS       T02256                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00010  Glycolysis / Gluconeogenesis
eso00620  Pyruvate metabolism
eso00640  Propanoate metabolism
eso00680  Methane metabolism
eso01100  Metabolic pathways
eso01110  Biosynthesis of secondary metabolites
eso01120  Microbial metabolism in diverse environments
eso01130  Biosynthesis of antibiotics
eso01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    O3O_01850
   00620 Pyruvate metabolism
    O3O_01850
   00640 Propanoate metabolism
    O3O_01850
  Energy metabolism
   00680 Methane metabolism
    O3O_01850
Enzymes [BR:eso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     O3O_01850
Lipid biosynthesis proteins [BR:eso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   O3O_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFS84160
Position
4892183..4894141
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgtacctgataccttctggggc
gaacagggaaaaattctcgactggatcaaaccttaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgcaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgcattggcgcggtgcattcg
gtgattttcggcggcttctcgccggaagccgttgccgggcgcattattgattccaactca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgcagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcgggaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagcgagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctacacctccggttctaccggtaagccaaaaggtgtgctgcatactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggtgatatc
tactggtgcaccgccgatgtgggctgggtgaccggacacagttacttgctgtacggcccg
ctggcctgcggtgcgaccacgctgatgtttgaaggcgtacccaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcacccacggcg
atccgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaactggcggt
ttcatgatcacgccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggcgctacc
gaaggcagcctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgaacagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgtgtggacgacgtgctg
aacgtctccggtcaccgtctggggacggcagagattgagtcggcgctggtggcgcatccg
aagattgccgaagccgccgtagtaggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system