KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_02975Help
Entry
O3O_02975         CDS       T02256                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    O3O_02975 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3O_02975 (pyrB)
Enzymes [BR:eso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     O3O_02975 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4661177..4662112
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKF
DGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVIAEVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcagaaacatatcatttccataaacgaccttagtcgcgatgac
cttaatctggtgctggcgacagcggcgaaactgaaagcaaacccgcaaccagagctgttg
aagcacaaagtcattgccagctgtttcttcgaagcctctacccgtacccgcctctctttc
gaaacatctatgcaccgcctgggtgccagcgtggtgggcttctccgacagcgccaataca
tcactgggtaaaaagggcgaaacgctggccgataccatttcggttatcagcacttacgtc
gatgcgatagtgatgcgtcatccgcaggaaggtgcggcgcgcctggccaccgagttttcc
ggcaatgtaccggtactgaatgccggtgatggctccaaccaacatccgacgcaaaccttg
ctggacttattcactattcaggaaacccaggggcgtctggacaatctccacgtcgcaatg
gttggtgacctgaaatatggccgcaccgttcactccctgactcaggcgttagcgaagttc
gacggcaaccgtttttacttcatcgcgccggacgcgctggcaatgccgcaatacattctg
gatatgctcgatgaaaaagggatcgcatggagtctgcacagctctattgaagaagtgata
gcggaagtagacatcctgtacatgacccgcgtgcaaaaagagcgtctggacccgtccgag
tacgccaacgtgaaagcgcagtttgttcttcgcgccagcgatctccacaacgccaaagcc
aatatgaaagtgctgcatccgctgccgcgtgttgatgagattgcgacggatgttgataaa
acgccacacgcctggtacttccagcaggcaggcaacgggattttcgctcgccaggcgtta
ctggcactggttctgaatcgcgatctggtactgtaa

DBGET integrated database retrieval system